PAR2(F2RL1) (NM_005242) Human Tagged ORF Clone

CAT#: RC202121

F2RL1 (Myc-DDK-tagged)-Human coagulation factor II (thrombin) receptor-like 1 (F2RL1)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name PAR2(F2RL1) (NM_005242) Human Tagged ORF Clone
Symbol F2RL1
Synonyms GPR11; PAR2
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC202121 representing NM_005242
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCGGAGCCCCAGCGCGGCGTGGCTGCTGGGGGCCGCCATCCTGCTAGCAGCCTCTCTCTCCTGCAGTG
GCACCATCCAAGGAACCAATAGATCCTCTAAAGGAAGAAGCCTTATTGGTAAGGTTGATGGCACATCCCA
CGTCACTGGAAAAGGAGTTACAGTTGAAACAGTCTTTTCTGTGGATGAGTTTTCTGCATCTGTCCTCACT
GGAAAACTGACCACTGTCTTCCTTCCAATTGTCTACACAATTGTGTTTGTGGTGGGTTTGCCAAGTAACG
GCATGGCCCTGTGGGTCTTTCTTTTCCGAACTAAGAAGAAGCACCCTGCTGTGATTTACATGGCCAATCT
GGCCTTGGCTGACCTCCTCTCTGTCATCTGGTTCCCCTTGAAGATTGCCTATCACATACATGGCAACAAC
TGGATTTATGGGGAAGCTCTTTGTAATGTGCTTATTGGCTTTTTCTATGGCAACATGTACTGTTCCATTC
TCTTCATGACCTGCCTCAGTGTGCAGAGGTATTGGGTCATCGTGAACCCCATGGGGCACTCCAGGAAGAA
GGCAAACATTGCCATTGGCATCTCCCTGGCAATATGGCTGCTGATTCTGCTGGTCACCATCCCTTTGTAT
GTCGTGAAGCAGACCATCTTCATTCCTGCCCTGAACATCACGACCTGTCATGATGTTTTGCCTGAGCAGC
TCTTGGTGGGAGACATGTTCAATTACTTCCTCTCTCTGGCCATTGGGGTCTTTCTGTTCCCAGCCTTCCT
CACAGCCTCTGCCTATGTGCTGATGATCAGAATGCTGCGATCTTCTGCCATGGATGAAAACTCAGAGAAG
AAAAGGAAGAGGGCCATCAAACTCATTGTCTCTGTCCTGGCCATGTACCTGATCTGCTTCACTCCTAGTA
ACCTTCTGCTTGTGGTGCATTATTTTCTGATTAAGAGCCAGGGCCAGAGCCATGTCTATGCCCTGTACAT
TGTAGCCCTCTGCCTCTCTACCCTTAACAGCTGCATCGACCCCTTTGTCTATTACTTTGTTTCACATGAT
TTCAGGGATCATGCAAAGAACGCTCTCCTTTGCCGAAGTGTCCGCACTGTAAAGCAGATGCAAGTATCCC
TCACCTCAAAGAAACACTCCAGGAAATCCAGCTCTTACTCTTCAAGTTCAACCACTGTTAAGACCTCCTA
T


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC202121 representing NM_005242
Red=Cloning site Green=Tags(s)

MRSPSAAWLLGAAILLAASLSCSGTIQGTNRSSKGRSLIGKVDGTSHVTGKGVTVETVFSVDEFSASVLT
GKLTTVFLPIVYTIVFVVGLPSNGMALWVFLFRTKKKHPAVIYMANLALADLLSVIWFPLKIAYHIHGNN
WIYGEALCNVLIGFFYGNMYCSILFMTCLSVQRYWVIVNPMGHSRKKANIAIGISLAIWLLILLVTIPLY
VVKQTIFIPALNITTCHDVLPEQLLVGDMFNYFLSLAIGVFLFPAFLTASAYVLMIRMLRSSAMDENSEK
KRKRAIKLIVSVLAMYLICFTPSNLLLVVHYFLIKSQGQSHVYALYIVALCLSTLNSCIDPFVYYFVSHD
FRDHAKNALLCRSVRTVKQMQVSLTSKKHSRKSSSYSSSSTTVKTSY

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_005242
ORF Size 1191 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_005242.1, NM_005242.2, NM_005242.3, NM_005242.4, NM_005242.5, NP_005233
RefSeq Size 2876
RefSeq ORF 1194
Locus ID 2150
Cytogenetics 5q13.3
Domains 7tm_1
Protein Families GPCR, Transmembrane, Druggable Genome
Protein Pathways Neuroactive ligand-receptor interaction
MW 43.9 kDa
Gene Summary This gene encodes a member of the G-protein coupled receptor 1 family of proteins. The encoded cell surface receptor is activated through proteolytic cleavage of its extracellular amino terminus, resulting in a new amino terminus that acts as a tethered ligand that binds to an extracellular loop domain. Activation of the receptor has been shown to stimulate vascular smooth muscle relaxation, dilate blood vessels, increase blood flow, and lower blood pressure. This protein is also important in the inflammatory response, as well as innate and adaptive immunity. [provided by RefSeq, Jun 2016].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)