RPA70 (RPA1) (NM_002945) Human Tagged ORF Clone

CAT#: RC202066

Reviews ()
Write a review

RPA1 (Myc-DDK-tagged)-Human replication protein A1, 70kDa (RPA1)



  "NM_002945" in other vectors (7)

Reconstitution Protocol

USD 573.00

In Stock*

Size
    • 10 ug

Product images

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "RPA1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol RPA1
Synonyms HSSB; MST075; REPA1; RF-A; RP-A; RPA70
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC202066 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTCGGCCAACTGAGCGAGGGGGCCATTGCGGCCATCATGCAGAAGGGGGATACAAACATAAAGCCCA
TCCTCCAAGTCATCAACATCCGTCCCATTACTACGGGGAATAGTCCGCCGCGTTATCGACTGCTCATGAG
TGATGGATTGAACACTCTATCCTCTTTCATGTTGGCGACACAGTTGAACCCTCTCGTGGAGGAAGAACAA
TTGTCCAGCAACTGTGTATGCCAGATTCACAGATTTATTGTGAACACTCTGAAAGACGGAAGGAGAGTAG
TTATCTTGATGGAATTAGAAGTTTTGAAGTCAGCTGAAGCAGTTGGAGTGAAGATTGGCAATCCAGTGCC
CTATAATGAAGGACTCGGGCAGCCGCAAGTAGCTCCTCCAGCGCCAGCAGCCAGCCCAGCAGCAAGCAGC
AGGCCCCAGCCGCAGAATGGAAGCTCGGGAATGGGTTCTACTGTTTCTAAGGCTTATGGTGCTTCAAAGA
CATTTGGAAAAGCTGCAGGTCCCAGCCTGTCACACACTTCTGGGGGAACACAGTCCAAAGTGGTGCCCAT
TGCCAGCCTCACTCCTTACCAGTCCAAGTGGACCATTTGTGCTCGTGTTACCAACAAAAGTCAGATCCGT
ACCTGGAGCAACTCCCGAGGGGAAGGGAAGCTTTTCTCCCTAGAACTGGTTGACGAAAGTGGTGAAATCC
GAGCTACAGCTTTCAATGAGCAAGTGGACAAGTTCTTTCCTCTTATTGAAGTGAACAAGGTGTATTATTT
CTCGAAAGGCACCCTGAAGATTGCTAACAAGCAGTTCACAGCTGTTAAAAATGACTACGAGATGACCTTC
AATAACGAGACTTCCGTCATGCCCTGTGAGGACGACCATCATTTACCTACGGTTCAGTTTGATTTCACGG
GGATTGATGACCTCGAGAACAAGTCGAAAGACTCACTTGTAGACATCATCGGGATCTGCAAGAGCTATGA
AGACGCCACTAAAATCACAGTGAGGTCTAACAACAGAGAAGTTGCCAAGAGGAATATCTACTTGATGGAC
ACATCTGGGAAGGTGGTGACTGCTACACTGTGGGGGGAAGATGCTGATAAATTTGATGGTTCTAGACAGC
CCGTGTTGGCTATCAAAGGAGCCCGAGTCTCTGATTTCGGTGGACGGAGCCTCTCCGTGCTGTCTTCAAG
CACTATCATTGCGAATCCTGACATCCCAGAGGCCTATAAGCTTCGTGGATGGTTTGACGCAGAAGGACAA
GCCTTAGATGGTGTTTCCATCTCTGATCTAAAGAGCGGCGGAGTCGGAGGGAGTAACACCAACTGGAAAA
CCTTGTATGAGGTCAAATCCGAGAACCTGGGCCAAGGCGACAAGCCGGACTACTTTAGTTCTGTGGCCAC
AGTGGTGTATCTTCGCAAAGAGAACTGCATGTACCAAGCCTGCCCGACTCAGGACTGCAATAAGAAAGTG
ATTGATCAACAGAATGGATTGTACCGCTGTGAGAAGTGCGACACCGAATTTCCCAATTTCAAGTACCGCA
TGATCCTGTCAGTAAATATTGCAGATTTTCAAGAGAATCAGTGGGTGACTTGTTTCCAGGAGTCTGCTGA
AGCTATCCTTGGACAAAATGCTGCTTATCTTGGGGAATTAAAAGACAAGAATGAACAGGCATTTGAAGAA
GTTTTCCAGAATGCCAACTTCCGATCTTTCATATTCAGAGTCAGGGTCAAAGTGGAGACCTACAACGACG
AGTCTCGAATTAAGGCCACTGTGATGGACGTGAAGCCCGTGGACTACAGAGAGTATGGCCGAAGGCTGGT
CATGAGCATCAGGAGAAGTGCATTGATG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC202066 protein sequence
Red=Cloning site Green=Tags(s)

MVGQLSEGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQ
LSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYNEGLGQPQVAPPAPAASPAASS
RPQPQNGSSGMGSTVSKAYGASKTFGKAAGPSLSHTSGGTQSKVVPIASLTPYQSKWTICARVTNKSQIR
TWSNSRGEGKLFSLELVDESGEIRATAFNEQVDKFFPLIEVNKVYYFSKGTLKIANKQFTAVKNDYEMTF
NNETSVMPCEDDHHLPTVQFDFTGIDDLENKSKDSLVDIIGICKSYEDATKITVRSNNREVAKRNIYLMD
TSGKVVTATLWGEDADKFDGSRQPVLAIKGARVSDFGGRSLSVLSSSTIIANPDIPEAYKLRGWFDAEGQ
ALDGVSISDLKSGGVGGSNTNWKTLYEVKSENLGQGDKPDYFSSVATVVYLRKENCMYQACPTQDCNKKV
IDQQNGLYRCEKCDTEFPNFKYRMILSVNIADFQENQWVTCFQESAEAILGQNAAYLGELKDKNEQAFEE
VFQNANFRSFIFRVRVKVETYNDESRIKATVMDVKPVDYREYGRRLVMSIRRSALM

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_002945
ORF Size 1848 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_002945.2, NP_002936.1
RefSeq Size 4345 bp
RefSeq ORF 1851 bp
Locus ID 6117
UniProt ID P27694
Cytogenetics 17p13.3
Domains tRNA_anti, Rep-A_N
Protein Families Druggable Genome, Stem cell - Pluripotency
Protein Pathways DNA replication, Homologous recombination, Mismatch repair, Nucleotide excision repair
MW 68.1 kDa
Gene Summary This gene encodes the largest subunit of the heterotrimeric Replication Protein A (RPA) complex, which binds to single-stranded DNA (ssDNA), forming a nucleoprotein complex that plays an important role in DNA metabolism, being involved in DNA replication, repair, recombination, telomere maintenance, and co-ordinating the cellular response to DNA damage through activation of the ataxia telangiectasia and Rad3-related protein (ATR) kinase. The nucleoprotein complex protects the single-stranded DNA from nucleases, prevents formation of secondary structures that would interfere with repair, and co-ordinates the recruitment and departure of different genome maintenance factors. This subunit contains four oligonucleotide/oligosaccharide-binding (OB) domains, though the majority of ssDNA binding occurs in two of these domains. The heterotrimeric complex has two different modes of ssDNA binding, a low-affinity and high-affinity mode, determined by which ssDNA binding domains are utilized. The different binding modes differ in the length of DNA bound and in the proteins with which it interacts, thereby playing a role in regulating different genomic maintenance pathways. [provided by RefSeq, Sep 2017]

Other Versions

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.