Calpain 5(CAPN5) (NM_004055) Human Tagged ORF Clone

CAT#: RC202045

CAPN5 (Myc-DDK-tagged)-Human calpain 5 (CAPN5)

Need custom modification / cloning service?
Get a free quote

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name Calpain 5(CAPN5) (NM_004055) Human Tagged ORF Clone
Symbol CAPN5
Synonyms ADNIV; HTRA3; nCL-3; VRNI
Vector pCMV6-Entry
Sequence Data
>RC202045 representing NM_004055
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTCTCGTGTGTGAAGCCCTATGAGGACCAGAACTACTCAGCCCTGAGGCGGGACTGCCGGCGCAGGA
AGGTGCTCTTCGAGGACCCCCTCTTCCCCGCCACTGACGACTCACTCTACTATAAGGGCACGCCGGGGCC
CGCCGTCAGGTGGAAGCGACCCAAGGGCATCTGCGAGGACCCCCGCCTCTTTGTGGATGGCATCAGCTCC
CACGACCTGCACCAGGGCCAGGTGGGCAACTGCTGGTTTGTGGCAGCCTGCTCGTCACTTGCCTCCCGGG
AGTCGCTGTGGCAAAAGGTCATCCCAGACTGGAAGGAGCAGGAATGGGACCCCGAAAAGCCCAACGCCTA
CGCGGGCATCTTCCACTTCCACTTCTGGCGCTTCGGGGAATGGGTGGACGTGGTCATCGATGACCGGCTG
CCCACAGTCAACAACCAGCTCATCTACTGCCACTCCAACTCCCGCAATGAGTTTTGGTGCGCCCTAGTGG
AGAAGGCCTATGCCAAACTGGCAGGCTGTTACCAGGCCCTGGATGGAGGCAACACAGCAGACGCACTGGT
GGACTTCACGGGTGGTGTTTCTGAGCCCATCGACCTGACCGAGGGTGACTTTGCCAACGATGAGACTAAG
AGGAACCAGCTCTTTGAGCGCATGTTAAAGGTGCACAGCCGGGGCGGCCTCATCAGTGCCTCCATCAAGG
CAGTGACAGCAGCTGACATGGAGGCCCGCCTGGCGTGCGGCCTGGTAAAGGGCCACGCATACGCCGTCAC
TGATGTGCGCAAGGTGCGCCTGGGCCACGGCCTACTGGCCTTCTTCAAGTCAGAGAAGTTGGACATGATC
CGCCTGCGCAACCCCTGGGGCGAGCGGGAGTGGAACGGGCCCTGGAGTGACACCTCGGAGGAGTGGCAGA
AAGTGAGCAAGAGTGAGCGGGAGAAGATGGGTGTGACCGTGCAGGACGACGGTGAGTTCTGGATGACCTT
CGAGGACGTGTGCCGGTACTTCACGGACATCATCAAGTGCCGCGTGATCAACACATCCCACCTGAGCATC
CACAAGACGTGGGAGGAGGCCCGGCTGCATGGCGCCTGGACGCTGCATGAGGACCCGCGACAGAACCGCG
GTGGCGGCTGCATCAACCACAAGGACACCTTCTTCCAGAACCCACAGTACATCTTCGAAGTCAAGAAGCC
AGAAGATGAAGTCCTGATCTGCATCCAGCAGCGGCCAAAGCGGTCTACGCGCCGGGAGGGCAAGGGTGAG
AACCTGGCCATTGGCTTTGACATCTACAAGGTGGAGGAGAACCGCCAGTACCGCATGCACAGCCTGCAGC
ACAAGGCCGCCAGCTCCATCTACATCAACTCACGCAGCGTCTTCCTGCGCACCGACCAGCCCGAGGGCCG
CTATGTCATCATCCCCACAACCTTCGAGCCAGGCCACACTGGCGAGTTCCTGCTCCGAGTCTTCACTGAT
GTGCCCTCCAACTGCCGGGAGCTGCGCCTGGATGAGCCCCCACACACCTGCTGGAGCTCCCTCTGTGGCT
ACCCCCAGCTGGTGACCCAGGTACATGTCCTGGGAGCTGCTGGCCTCAAGGACTCCCCAACAGGGGCTAA
CTCTTATGTGATCATCAAGTGTGAGGGAGACAAAGTCCGCTCGGCTGTGCAGAAGGGCACCTCCACACCA
GAGTACAATGTGAAAGGCATCTTCTACCGCAAGAAGCTGAGCCAGCCCATCACTGTACAGGTCTGGAACC
ACCGAGTGCTGAAGGATGAATTTCTGGGCCAGGTGCACCTAAAGGCTGACCCGGACAACCTCCAGGCCCT
GCATACCCTCCACCTCCGGGACCGAAATAGCCGGCAGCCCAGCAACCTGCCAGGCACTGTGGCCGTGCAC
ATTCTCAGCAGCACCTCCCTCATGGCTGTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC202045 representing NM_004055
Red=Cloning site Green=Tags(s)

MFSCVKPYEDQNYSALRRDCRRRKVLFEDPLFPATDDSLYYKGTPGPAVRWKRPKGICEDPRLFVDGISS
HDLHQGQVGNCWFVAACSSLASRESLWQKVIPDWKEQEWDPEKPNAYAGIFHFHFWRFGEWVDVVIDDRL
PTVNNQLIYCHSNSRNEFWCALVEKAYAKLAGCYQALDGGNTADALVDFTGGVSEPIDLTEGDFANDETK
RNQLFERMLKVHSRGGLISASIKAVTAADMEARLACGLVKGHAYAVTDVRKVRLGHGLLAFFKSEKLDMI
RLRNPWGEREWNGPWSDTSEEWQKVSKSEREKMGVTVQDDGEFWMTFEDVCRYFTDIIKCRVINTSHLSI
HKTWEEARLHGAWTLHEDPRQNRGGGCINHKDTFFQNPQYIFEVKKPEDEVLICIQQRPKRSTRREGKGE
NLAIGFDIYKVEENRQYRMHSLQHKAASSIYINSRSVFLRTDQPEGRYVIIPTTFEPGHTGEFLLRVFTD
VPSNCRELRLDEPPHTCWSSLCGYPQLVTQVHVLGAAGLKDSPTGANSYVIIKCEGDKVRSAVQKGTSTP
EYNVKGIFYRKKLSQPITVQVWNHRVLKDEFLGQVHLKADPDNLQALHTLHLRDRNSRQPSNLPGTVAVH
ILSSTSLMAV

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_004055
ORF Size 1920 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_004055.2, NM_004055.3, NM_004055.4, NP_004046
RefSeq Size 3275
RefSeq ORF 1923
Locus ID 726
Cytogenetics 11q13.5
Domains C2, calpain_III
Protein Families Protease, Druggable Genome
MW 73 kDa
Gene Summary Calpains are calcium-dependent cysteine proteases involved in signal transduction in a variety of cellular processes. A functional calpain protein consists of an invariant small subunit and 1 of a family of large subunits. CAPN5 is one of the large subunits. Unlike some of the calpains, CAPN5 and CAPN6 lack a calmodulin-like domain IV. Because of the significant similarity to Caenorhabditis elegans sex determination gene tra-3, CAPN5 is also called as HTRA3. [provided by RefSeq, Jul 2008]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)