PI 3 Kinase p55 gamma(PIK3R3) (NM_003629) Human Tagged ORF Clone

CAT#: RC202039

PIK3R3 (Myc-DDK-tagged)-Human phosphoinositide-3-kinase, regulatory subunit 3 (gamma) (PIK3R3), transcript variant 1

Change vector?

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name PI 3 Kinase p55 gamma(PIK3R3) (NM_003629) Human Tagged ORF Clone
Symbol PIK3R3
Synonyms p55; p55-GAMMA; p55PIK
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC202039 representing NM_003629
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTACAATACGGTGTGGAGTATGGACCGCGATGACGCAGACTGGAGGGAGGTGATGATGCCCTATTCGA
CAGAACTGATATTTTATATTGAAATGGATCCTCCAGCTCTTCCACCAAAGCCACCTAAGCCAATGACTTC
AGCAGTTCCAAATGGAATGAAGGACAGTTCTGTTTCTCTTCAGGATGCAGAATGGTACTGGGGGGATATT
TCAAGGGAGGAGGTAAATGACAAATTGCGGGATATGCCAGATGGGACCTTCTTGGTCCGAGATGCCTCAA
CAAAAATGCAGGGAGATTATACTTTGACTTTGCGGAAGGGAGGCAATAATAAGTTAATAAAGATCTATCA
CCGGGATGGTAAATATGGCTTTTCTGATCCTCTGACATTTAATTCCGTGGTGGAGCTCATTAACCACTAT
CACCATGAATCTCTTGCTCAGTACAATCCCAAACTTGATGTGAAGCTGATGTACCCAGTGTCCAGATACC
AACAGGATCAGTTGGTAAAAGAAGATAATATTGATGCAGTAGGTAAAAAACTGCAAGAATACCACTCTCA
GTATCAGGAGAAGAGTAAAGAGTATGATAGGCTGTATGAAGAATATACTAGAACATCCCAGGAAATACAG
ATGAAGAGGACTGCAATAGAAGCTTTTAATGAAACAATTAAAATATTTGAAGAGCAGTGTCACACACAAG
AACAACATAGCAAAGAATATATTGAGCGATTTCGCAGAGAGGGGAATGAAAAGGAGATTGAACGAATTAT
GATGAATTATGATAAATTGAAATCACGTCTGGGTGAGATTCATGATAGCAAAATGCGTCTAGAGCAGGAT
TTGAAGAATCAAGCTTTGGACAACCGAGAAATAGATAAAAAAATGAATAGCATCAAACCTGACCTGATCC
AGCTGCGAAAGATCCGAGATCAACACCTTGTATGGCTCAATCACAAAGGAGTGAGACAGAAACGCCTGAA
TGTCTGGCTGGGAATTAAGAATGAGGATGCTGCTGAGAACTATTTTATCAATGAGGAAGATGAAAACCTG
CCCCATTATGATGAGAAAACCTGGTTTGTTGAGGATATCAATCGAGTACAAGCAGAGGACTTGCTTTATG
GGAAACCTGATGGTGCATTCTTAATTCGTGAGAGTAGCAAGAAAGGATGCTATGCTTGCTCTGTGGTGGC
CGATGGGGAAGTGAAGCACTGTGTGATCTACAGCACTGCTCGGGGCTATGGCTTTGCAGAGCCCTACAAC
CTGTACAGCTCTCTGAAGGAGCTAGTGCTCCATTACCAGCAGACATCCTTGGTTCAGCACAACGACTCCC
TCAACGTCAGGCTTGCCTACCCTGTTCATGCACAGATGCCCTCGCTTTGCAGA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC202039 representing NM_003629
Red=Cloning site Green=Tags(s)

MYNTVWSMDRDDADWREVMMPYSTELIFYIEMDPPALPPKPPKPMTSAVPNGMKDSSVSLQDAEWYWGDI
SREEVNDKLRDMPDGTFLVRDASTKMQGDYTLTLRKGGNNKLIKIYHRDGKYGFSDPLTFNSVVELINHY
HHESLAQYNPKLDVKLMYPVSRYQQDQLVKEDNIDAVGKKLQEYHSQYQEKSKEYDRLYEEYTRTSQEIQ
MKRTAIEAFNETIKIFEEQCHTQEQHSKEYIERFRREGNEKEIERIMMNYDKLKSRLGEIHDSKMRLEQD
LKNQALDNREIDKKMNSIKPDLIQLRKIRDQHLVWLNHKGVRQKRLNVWLGIKNEDAAENYFINEEDENL
PHYDEKTWFVEDINRVQAEDLLYGKPDGAFLIRESSKKGCYACSVVADGEVKHCVIYSTARGYGFAEPYN
LYSSLKELVLHYQQTSLVQHNDSLNVRLAYPVHAQMPSLCR

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_003629
ORF Size 1383 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_003629.1, NM_003629.2, NM_003629.3, NP_003620
RefSeq Size 5621
Locus ID 8503
Cytogenetics 1p34.1
Domains SH2
Protein Families Druggable Genome
Protein Pathways ErbB signaling pathway, Chemokine signaling pathway, Phosphatidylinositol signaling system, mTOR signaling pathway, Apoptosis, VEGF signaling pathway, Focal adhesion, Toll-like receptor signaling pathway, Jak-STAT signaling pathway, Natural killer cell mediated cytotoxicity, T cell receptor signaling pathway, B cell receptor signaling pathway, Fc epsilon RI signaling pathway, Fc gamma R-mediated phagocytosis, Leukocyte transendothelial migration, Neurotrophin signaling pathway, Regulation of actin cytoskeleton, Insulin signaling pathway, Progesterone-mediated oocyte maturation, Type II diabetes mellitus, Pathways in cancer, Colorectal cancer, Renal cell carcinoma, Pancreatic cancer, Endometrial cancer, Glioma, Prostate cancer, Melanoma, Chronic myeloid leukemia, Acute myeloid leukemia, Small cell lung cancer, Non-small cell lung cancer
MW 54.3 kDa
Gene Summary Phosphatidylinositol 3-kinase (PI3K) phosphorylates phosphatidylinositol and similar compounds, which then serve as second messengers in growth signaling pathways. PI3K is composed of a catalytic and a regulatory subunit. The protein encoded by this gene represents a regulatory subunit of PI3K. The encoded protein contains two SH2 domains through which it binds activated protein tyrosine kinases to regulate their activity. [provided by RefSeq, Jun 2016].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.