FE65(APBB1) (NM_001164) Human Tagged ORF Clone

CAT#: RC202003

APBB1 (Myc-DDK-tagged)-Human amyloid beta (A4) precursor protein-binding, family B, member 1 (Fe65) (APBB1), transcript variant 1

Clone Modification / Custom Cloning Service

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name FE65(APBB1) (NM_001164) Human Tagged ORF Clone
Symbol APBB1
Synonyms FE65; MGC:9072; RIR
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC202003 representing NM_001164
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCTGTTCCATCATCACTGAGCCAGTCGGCCATTAATGCCAACAGCCACGGAGGCCCCGCACTGAGCC
TACCCCTGCCTCTGCACGCTGCCCACAACCAGCTGCTCAACGCCAAGCTGCAGGCCACAGCTGTGGGACC
CAAGGACCTGCGCAGCGCCATGGGGGAGGGTGGTGGGCCTGAGCCAGGCCCTGCCAATGCCAAGTGGCTA
AAAGAGGGCCAGAACCAGCTCCGGCGGGCCGCCACGGCCCACCGTGACCAGAATCGCAATGTGACCTTGA
CCTTGGCGGAGGAGGCCAGCCAGGAGCCTGAGATGGCACCCTTGGGCCCCAAAGGCCTGATACACCTGTA
CTCTGAGCTGGAGCTCTCAGCTCACAACGCAGCCAACCGAGGCCTACGAGGACCTGGCCTGATCATCAGC
ACTCAAGAGCAGGGGCCAGATGAGGGAGAGGAGAAGGCGGCCGGGGAGGCCGAGGAGGAGGAGGAGGATG
ATGATGATGAAGAGGAGGAGGAGGACTTATCTTCTCCCCCAGGGCTGCCTGAGCCCCTGGAGAGTGTGGA
GGCCCCTCCCAGGCCCCAAGCCCTTACAGATGGCCCCCGGGAACACAGCAAGAGTGCCAGCCTCCTGTTT
GGCATGCGGAACAGTGCAGCCAGTGATGAGGACTCAAGCTGGGCTACCTTATCCCAGGGCAGCCCCTCCT
ATGGCTCCCCAGAGGACACAGATTCCTTCTGGAACCCCAACGCCTTCGAGACGGATTCCGACCTGCCGGC
TGGATGGATGAGGGTCCAGGACACCTCAGGGACCTATTACTGGCACATCCCAACAGGGACCACCCAGTGG
GAACCCCCCGGCCGGGCCTCCCCCTCACAGGGGAGCAGCCCCCAAGAGGAGTCCCAGCTCACCTGGACAG
GTTTTGCTCATGGAGAAGGCTTTGAGGATGGAGAATTTTGGAAGGATGAACCCAGTGATGAGGCCCCAAT
GGAGCTGGGACTGAAGGAACCTGAGGAGGGGACGTTGACCTTCCCAGCTCAGAGCCTCAGCCCAGAGCCG
TTGCCCCAAGAGGAGGAGAAGCTTCCCCCACGGAATACCAACCCAGGGATCAAGTGTTTCGCCGTGCGCT
CCCTAGGCTGGGTAGAGATGACCGAGGAGGAGCTGGCCCCTGGACGCAGCAGTGTGGCAGTCAACAATTG
CATCCGTCAGCTCTCTTACCACAAAAACAACCTGCATGACCCCATGTCTGGGGGCTGGGGGGAAGGAAAG
GATCTGCTACTGCAGCTGGAGGATGAGACACTAAAGCTAGTGGAGCCACAGAGCCAGGCACTGCTGCACG
CCCAACCCATCATCAGCATCCGCGTGTGGGGCGTCGGGCGGGACAGTGGAAGGGACTTTGCCTACGTAGC
TCGTGATAAGCTGACCCAGATGCTCAAGTGCCACGTGTTTCGCTGTGAGGCACCTGCCAAGAACATCGCC
ACCAGCCTGCATGAGATCTGCTCTAAGATCATGGCCGAACGGCGTAATGCCCGCTGCTTGGTAAATGGAC
TCTCCCTGGACCACTCTAAACTTGTGGATGTCCCTTTCCAAGTGGAATTCCCAGCGCCTAAGAATGAGTT
GGTCCAGAAGTTCCAAGTCTATTACCTGGGGAATGTACCTGTTGCTAAACCTGTTGGGGTAGATGTGATT
AATGGGGCCCTCGAGTCAGTCCTGTCCTCCAGCAGCCGTGAACAATGGACCCCAAGTCATGTCAGTGTGG
CCCCTGCTACCCTCACCATCTTGCACCAGCAGACAGAGGCAGTGCTGGGAGAGTGTCGGGTGCGTTTCCT
CTCCTTCCTGGCCGTGGGCAGAGATGTCCACACGTTTGCATTCATCATGGCTGCCGGCCCAGCCTCCTTC
TGCTGCCACATGTTCTGGTGCGAGCCCAATGCTGCCAGCCTCTCAGAGGCTGTGCAGGCTGCGTGCATGC
TTCGCTACCAGAAGTGTCTGGATGCCCGTTCCCAGGCCTCCACCTCCTGCCTCCCAGCACCCCCTGCTGA
GTCTGTGGCACGGCGTGTAGGGTGGACTGTCCGCAGGGGTGTTCAGTCGCTGTGGGGCTCCCTGAAGCCC
AAACGGCTGGGGGCCCATACCCCA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC202003 representing NM_001164
Red=Cloning site Green=Tags(s)

MSVPSSLSQSAINANSHGGPALSLPLPLHAAHNQLLNAKLQATAVGPKDLRSAMGEGGGPEPGPANAKWL
KEGQNQLRRAATAHRDQNRNVTLTLAEEASQEPEMAPLGPKGLIHLYSELELSAHNAANRGLRGPGLIIS
TQEQGPDEGEEKAAGEAEEEEEDDDDEEEEEDLSSPPGLPEPLESVEAPPRPQALTDGPREHSKSASLLF
GMRNSAASDEDSSWATLSQGSPSYGSPEDTDSFWNPNAFETDSDLPAGWMRVQDTSGTYYWHIPTGTTQW
EPPGRASPSQGSSPQEESQLTWTGFAHGEGFEDGEFWKDEPSDEAPMELGLKEPEEGTLTFPAQSLSPEP
LPQEEEKLPPRNTNPGIKCFAVRSLGWVEMTEEELAPGRSSVAVNNCIRQLSYHKNNLHDPMSGGWGEGK
DLLLQLEDETLKLVEPQSQALLHAQPIISIRVWGVGRDSGRDFAYVARDKLTQMLKCHVFRCEAPAKNIA
TSLHEICSKIMAERRNARCLVNGLSLDHSKLVDVPFQVEFPAPKNELVQKFQVYYLGNVPVAKPVGVDVI
NGALESVLSSSSREQWTPSHVSVAPATLTILHQQTEAVLGECRVRFLSFLAVGRDVHTFAFIMAAGPASF
CCHMFWCEPNAASLSEAVQAACMLRYQKCLDARSQASTSCLPAPPAESVARRVGWTVRRGVQSLWGSLKP
KRLGAHTP

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001164
ORF Size 2124 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001164.1, NM_001164.2, NM_001164.3, NM_001164.4, NP_001155
RefSeq Size 2653
RefSeq ORF 2133
Locus ID 322
Cytogenetics 11p15.4
Domains WW, PID
Protein Families Transcription Factors
Protein Pathways Alzheimer's disease
MW 77.1 kDa
Gene Summary The protein encoded by this gene is a member of the Fe65 protein family. It is an adaptor protein localized in the nucleus. It interacts with the Alzheimer's disease amyloid precursor protein (APP), transcription factor CP2/LSF/LBP1 and the low-density lipoprotein receptor-related protein. APP functions as a cytosolic anchoring site that can prevent the gene product's nuclear translocation. This encoded protein could play an important role in the pathogenesis of Alzheimer's disease. It is thought to regulate transcription. Also it is observed to block cell cycle progression by downregulating thymidylate synthase expression. Multiple alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Mar 2012]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (2)