CD97(ADGRE5) (NM_001784) Human Tagged ORF Clone

CAT#: RC202001

CD97 (Myc-DDK-tagged)-Human CD97 molecule (CD97), transcript variant 2

Change vector?

USD 577


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name CD97(ADGRE5) (NM_001784) Human Tagged ORF Clone
Symbol ADGRE5
Synonyms CD97; TM7LN1
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC202001 representing NM_001784
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGAGGCCGCGTCTTTCTCGCATTCTGTGTCTGGCTGACTCTGCCGGGAGCTGAAACCCAGGACTCCA
GGGGCTGTGCCCGGTGGTGCCCTCAGAACTCCTCGTGTGTCAATGCCACCGCCTGTCGCTGCAATCCAGG
GTTCAGCTCTTTTTCTGAGATCATCACCACCCCGACGGAGACTTGTGACGACATCAACGAGTGTGCAACA
CCGTCGAAAGTGTCATGCGGAAAATTCTCGGACTGCTGGAACACAGAGGGGAGCTACGACTGCGTGTGCA
GCCCGGGATATGAGCCTGTTTCTGGGGCAAAAACATTCAAGAATGAGAGCGAGAACACCTGTCAAGATGT
GGACGAGTGCAGCTCCGGGCAGCATCAGTGTGACAGCTCCACCGTCTGCTTCAACACCGTGGGTTCATAC
AGCTGCCGCTGCCGCCCAGGCTGGAAGCCCAGACACGGAATCCCGAATAACCAAAAGGACACTGTCTGTG
AAGATATGACTTTCTCCACCTGGACCCCGCCCCCTGGAGTCCACAGCCAGACGCTTTCCCGATTCTTCGA
CAAAGTCCAGGACCTGGGCAGAGACTCCAAGACAAGCTCAGCCGAGGTCACCATCCAGAATGTCATCAAA
TTGGTGGATGAACTGATGGAAGCTCCTGGAGACGTAGAGGCCCTGGCGCCACCTGTCCGGCACCTCATAG
CCACCCAGCTGCTCTCAAACCTTGAAGATATCATGAGGATCCTGGCCAAGAGCCTGCCTAAAGGCCCCTT
CACCTACATTTCCCCTTCGAACACAGAGCTGACCCTGATGATCCAGGAGCGGGGGGACAAGAACGTCACT
ATGGGTCAGAGCAGCGCACGCATGAAGCTGAATTGGGCTGTGGCAGCTGGAGCCGAGGATCCAGGCCCCG
CCGTGGCGGGCATCCTCTCCATCCAGAACATGACGACATTGCTGGCCAATGCCTCCTTGAACCTGCATTC
CAAGAAGCAAGCCGAACTGGAGGAGATATATGAAAGCAGCATCCGTGGTGTCCAACTCAGACGCCTCTCT
GCCGTCAACTCCATCTTTCTGAGCCACAACAACACCAAGGAACTCAACTCCCCCATCCTTTTCGCCTTCT
CCCACCTTGAGTCCTCCGATGGGGAGGCGGGAAGAGACCCTCCTGCCAAGGACGTGATGCCTGGGCCACG
GCAGGAGCTGCTCTGTGCCTTCTGGAAGAGTGACAGCGACAGGGGAGGGCACTGGGCCACCGAGGGCTGC
CAGGTGCTGGGCAGCAAGAACGGCAGCACCACCTGCCAATGCAGCCACCTGAGCAGCTTTGCGATCCTTA
TGGCTCATTATGACGTGGAGGACTGGAAGCTGACCCTGATCACCAGGGTGGGACTGGCGCTGTCACTCTT
CTGCCTGCTGCTGTGCATCCTCACTTTCCTGCTGGTGCGGCCCATCCAGGGCTCGCGCACCACCATACAC
CTGCACCTCTGCATCTGCCTCTTCGTGGGCTCCACCATCTTCCTGGCCGGCATCGAGAACGAAGGCGGCC
AGGTGGGGCTGCGCTGCCGCCTGGTGGCCGGGCTGCTGCACTACTGTTTCCTGGCCGCCTTCTGCTGGAT
GAGCCTCGAAGGCCTGGAGCTCTACTTTCTTGTGGTGCGCGTGTTCCAAGGCCAGGGCCTGAGTACGCGC
TGGCTCTGCCTGATCGGCTATGGCGTGCCCCTGCTCATCGTGGGCGTCTCGGCTGCCATCTACAGCAAGG
GCTACGGCCGCCCCAGATACTGCTGGTTGGACTTTGAGCAGGGCTTCCTCTGGAGCTTCTTGGGACCTGT
GACCTTCATCATTTTGTGCAATGCTGTCATTTTCGTGACTACCGTCTGGAAGCTCACTCAGAAGTTTTCT
GAAATCAATCCAGACATGAAGAAATTAAAGAAGGCGAGGGCGCTGACCATCACGGCCATCGCGCAGCTCT
TCCTGTTGGGCTGCACCTGGGTCTTTGGCCTGTTCATCTTCGACGATCGGAGCTTGGTGCTGACCTATGT
GTTTACCATCCTCAACTGCCTGCAGGGCGCCTTCCTCTACCTGCTGCACTGCCTGCTCAACAAGAAGGTT
CGGGAAGAATACCGGAAGTGGGCCTGCCTAGTTGCTGGGGGGAGCAAGTACTCAGAATTCACCTCCACCA
CGTCTGGCACTGGCCACAATCAGACCCGGGCCCTCAGGGCATCAGAGTCCGGCATA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC202001 representing NM_001784
Red=Cloning site Green=Tags(s)

MGGRVFLAFCVWLTLPGAETQDSRGCARWCPQNSSCVNATACRCNPGFSSFSEIITTPTETCDDINECAT
PSKVSCGKFSDCWNTEGSYDCVCSPGYEPVSGAKTFKNESENTCQDVDECSSGQHQCDSSTVCFNTVGSY
SCRCRPGWKPRHGIPNNQKDTVCEDMTFSTWTPPPGVHSQTLSRFFDKVQDLGRDSKTSSAEVTIQNVIK
LVDELMEAPGDVEALAPPVRHLIATQLLSNLEDIMRILAKSLPKGPFTYISPSNTELTLMIQERGDKNVT
MGQSSARMKLNWAVAAGAEDPGPAVAGILSIQNMTTLLANASLNLHSKKQAELEEIYESSIRGVQLRRLS
AVNSIFLSHNNTKELNSPILFAFSHLESSDGEAGRDPPAKDVMPGPRQELLCAFWKSDSDRGGHWATEGC
QVLGSKNGSTTCQCSHLSSFAILMAHYDVEDWKLTLITRVGLALSLFCLLLCILTFLLVRPIQGSRTTIH
LHLCICLFVGSTIFLAGIENEGGQVGLRCRLVAGLLHYCFLAAFCWMSLEGLELYFLVVRVFQGQGLSTR
WLCLIGYGVPLLIVGVSAAIYSKGYGRPRYCWLDFEQGFLWSFLGPVTFIILCNAVIFVTTVWKLTQKFS
EINPDMKKLKKARALTITAIAQLFLLGCTWVFGLFIFDDRSLVLTYVFTILNCLQGAFLYLLHCLLNKKV
REEYRKWACLVAGGSKYSEFTSTTSGTGHNQTRALRASESGI

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001784
ORF Size 2226 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001784.1, NM_001784.2, NM_001784.3, NM_001784.4, NP_001775
RefSeq Size 2968
RefSeq ORF 2229
Locus ID 976
Cytogenetics 19p13.12
Domains GPS, 7tm_2, EGF_CA, EGF, EGF
Protein Families GPCR, Secreted Protein, ES Cell Differentiation/IPS, Transmembrane, Adult stem cells, Druggable Genome
MW 81.74 kDa
Gene Summary This gene encodes a member of the EGF-TM7 subfamily of adhesion G protein-coupled receptors, which mediate cell-cell interactions. These proteins are cleaved by self-catalytic proteolysis into a large extracellular subunit and seven-span transmembrane subunit, which associate at the cell surface as a receptor complex. The encoded protein may play a role in cell adhesion as well as leukocyte recruitment, activation and migration, and contains multiple extracellular EGF-like repeats which mediate binding to chondroitin sulfate and the cell surface complement regulatory protein CD55. Expression of this gene may play a role in the progression of several types of cancer. Alternatively spliced transcript variants encoding multiple isoforms with 3 to 5 EGF-like repeats have been observed for this gene. This gene is found in a cluster with other EGF-TM7 genes on the short arm of chromosome 19. [provided by RefSeq, Jun 2011].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.