ARSG (NM_014960) Human Tagged ORF Clone

CAT#: RC201967

ARSG (Myc-DDK-tagged)-Human arylsulfatase G (ARSG)

Clone Modification / Custom Cloning Service

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name ARSG (NM_014960) Human Tagged ORF Clone
Symbol ARSG
Synonyms KIAA1001
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC201967 representing NM_014960
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGCTGGCTTTTTCTAAAGGTTTTGTTGGCGGGAGTGAGTTTCTCAGGATTTCTTTATCCTCTTGTGG
ATTTTTGCATCAGTGGGAAAACAAGAGGACAGAAGCCAAACTTTGTGATTATTTTGGCCGATGACATGGG
GTGGGGTGACCTGGGAGCAAACTGGGCAGAAACAAAGGACACTGCCAACCTTGATAAGATGGCTTCGGAG
GGAATGAGGTTTGTGGATTTCCATGCAGCTGCCTCCACCTGCTCACCCTCCCGGGCTTCCTTGCTCACCG
GCCGGCTTGGCCTTCGCAATGGAGTCACACGCAACTTTGCAGTCACTTCTGTGGGAGGCCTTCCGCTCAA
CGAGACCACCTTGGCAGAGGTGCTGCAGCAGGCGGGTTACGTCACTGGGATAATAGGCAAATGGCATCTT
GGACACCACGGCTCTTATCACCCCAACTTCCGTGGTTTTGATTACTACTTTGGAATCCCATATAGCCATG
ATATGGGCTGTACTGATACTCCAGGCTACAACCACCCTCCTTGTCCAGCGTGTCCACAGGGTGATGGACC
ATCAAGGAACCTTCAAAGAGACTGTTACACTGACGTGGCCCTCCCTCTTTATGAAAACCTCAACATTGTG
GAGCAGCCGGTGAACTTGAGCAGCCTTGCCCAGAAGTATGCTGAGAAAGCAACCCAGTTCATCCAGCGTG
CAAGCACCAGCGGGAGGCCCTTCCTGCTCTATGTGGCTCTGGCCCACATGCACGTGCCCTTACCTGTGAC
TCAGCTACCAGCAGCGCCACGGGGCAGAAGCCTGTATGGTGCAGGGCTCTGGGAGATGGACAGTCTGGTG
GGCCAGATCAAGGACAAAGTTGACCACACAGTGAAGGAAAACACATTCCTCTGGTTTACAGGAGACAATG
GCCCGTGGGCTCAGAAGTGTGAGCTAGCGGGCAGTGTGGGTCCCTTCACTGGATTTTGGCAAACTCGTCA
AGGGGGAAGTCCAGCCAAGCAGACGACCTGGGAAGGAGGGCACCGGGTCCCAGCACTGGCTTACTGGCCT
GGCAGAGTTCCAGTTAATGTCACCAGCACTGCCTTGTTAAGCGTGCTGGACATTTTTCCAACTGTGGTAG
CCCTGGCCCAGGCCAGCTTACCTCAAGGACGGCGCTTTGATGGTGTGGACGTCTCCGAGGTGCTCTTTGG
CCGGTCACAGCCTGGGCACAGGGTGCTGTTCCACCCCAACAGCGGGGCAGCTGGAGAGTTTGGAGCCCTG
CAGACTGTCCGCCTGGAGCGTTACAAGGCCTTCTACATTACCGGTGGAGCCAGGGCGTGTGATGGGAGCA
CGGGGCCTGAGCTGCAGCATAAGTTTCCTCTGATTTTCAACCTGGAAGACGATACCGCAGAAGCTGTGCC
CCTAGAAAGAGGTGGTGCGGAGTACCAGGCTGTGCTGCCCGAGGTCAGAAAGGTTCTTGCAGACGTCCTC
CAAGACATTGCCAACGACAACATCTCCAGCGCAGATTACACTCAGGACCCTTCAGTAACTCCCTGCTGTA
ATCCCTACCAAATTGCCTGCCGCTGTCAAGCCGCA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC201967 representing NM_014960
Red=Cloning site Green=Tags(s)

MGWLFLKVLLAGVSFSGFLYPLVDFCISGKTRGQKPNFVIILADDMGWGDLGANWAETKDTANLDKMASE
GMRFVDFHAAASTCSPSRASLLTGRLGLRNGVTRNFAVTSVGGLPLNETTLAEVLQQAGYVTGIIGKWHL
GHHGSYHPNFRGFDYYFGIPYSHDMGCTDTPGYNHPPCPACPQGDGPSRNLQRDCYTDVALPLYENLNIV
EQPVNLSSLAQKYAEKATQFIQRASTSGRPFLLYVALAHMHVPLPVTQLPAAPRGRSLYGAGLWEMDSLV
GQIKDKVDHTVKENTFLWFTGDNGPWAQKCELAGSVGPFTGFWQTRQGGSPAKQTTWEGGHRVPALAYWP
GRVPVNVTSTALLSVLDIFPTVVALAQASLPQGRRFDGVDVSEVLFGRSQPGHRVLFHPNSGAAGEFGAL
QTVRLERYKAFYITGGARACDGSTGPELQHKFPLIFNLEDDTAEAVPLERGGAEYQAVLPEVRKVLADVL
QDIANDNISSADYTQDPSVTPCCNPYQIACRCQAA

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_014960
ORF Size 1575 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_014960.1, NM_014960.2, NM_014960.3, NM_014960.4, NP_055775
RefSeq Size 2028
RefSeq ORF 1578
Locus ID 22901
Cytogenetics 17q24.2
Domains Sulfatase
Protein Families Druggable Genome
Protein Pathways Lysosome
MW 56.9 kDa
Gene Summary The protein encoded by this gene belongs to the sulfatase enzyme family. Sulfatases hydrolyze sulfate esters from sulfated steroids, carbohydrates, proteoglycans, and glycolipids. They are involved in hormone biosynthesis, modulation of cell signaling, and degradation of macromolecules. This protein displays arylsulfatase activity at acidic pH, as is typical of lysosomal sulfatases, and has been shown to localize in the lysosomes. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jun 2012].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)