BCL2A1 (NM_004049) Human Tagged ORF Clone

CAT#: RC201965

BCL2A1 (Myc-DDK-tagged)-Human BCL2-related protein A1 (BCL2A1), transcript variant 1

Need custom modification / cloning service?
Get a free quote

USD 98.00

USD 390.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name BCL2A1 (NM_004049) Human Tagged ORF Clone
Symbol BCL2A1
Synonyms ACC-1; ACC-2; ACC1; ACC2; BCL2L5; BFL1; GRS; HBPA1
Vector pCMV6-Entry
Sequence Data
>RC201965 representing NM_004049
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACAGACTGTGAATTTGGATATATTTACAGGCTGGCTCAGGACTATCTGCAGTGCGTCCTACAGATAC
CACAACCTGGATCAGGTCCAAGCAAAACGTCCAGAGTGCTACAAAATGTTGCGTTCTCAGTCCAAAAAGA
AGTGGAAAAGAATCTGAAGTCATGCTTGGACAATGTTAATGTTGTGTCCGTAGACACTGCCAGAACACTA
TTCAACCAAGTGATGGAAAAGGAGTTTGAAGACGGCATCATTAACTGGGGAAGAATTGTAACCATATTTG
CATTTGAAGGTATTCTCATCAAGAAACTTCTACGACAGCAAATTGCCCCGGATGTGGATACCTATAAGGA
GATTTCATATTTTGTTGCGGAGTTCATAATGAATAACACAGGAGAATGGATAAGGCAAAACGGAGGCTGG
GAAAATGGCTTTGTAAAGAAGTTTGAACCTAAATCTGGCTGGATGACTTTTCTAGAAGTTACAGGAAAGA
TCTGTGAAATGCTATCTCTCCTGAAGCAATACTGT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC201965 representing NM_004049
Red=Cloning site Green=Tags(s)

MTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNVNVVSVDTARTL
FNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGW
ENGFVKKFEPKSGWMTFLEVTGKICEMLSLLKQYC

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_004049
ORF Size 525 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_004049.1, NM_004049.2, NM_004049.3, NP_004040
RefSeq Size 885
RefSeq ORF 528
Locus ID 597
Cytogenetics 15q25.1
Domains BCL
Protein Families Druggable Genome
Protein Pathways Metabolic pathways
MW 20 kDa
Gene Summary This gene encodes a member of the BCL-2 protein family. The proteins of this family form hetero- or homodimers and act as anti- and pro-apoptotic regulators that are involved in a wide variety of cellular activities such as embryonic development, homeostasis and tumorigenesis. The protein encoded by this gene is able to reduce the release of pro-apoptotic cytochrome c from mitochondria and block caspase activation. This gene is a direct transcription target of NF-kappa B in response to inflammatory mediators, and is up-regulated by different extracellular signals, such as granulocyte-macrophage colony-stimulating factor (GM-CSF), CD40, phorbol ester and inflammatory cytokine TNF and IL-1, which suggests a cytoprotective function that is essential for lymphocyte activation as well as cell survival. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)