spindlin 1 (SPIN1) (NM_006717) Human Tagged ORF Clone

CAT#: RC201938

SPIN1 (Myc-DDK-tagged)-Human spindlin 1 (SPIN1)

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK DDK w/ Puro mGFP mGFP w/ Puro

AAV Particle: DDK


  "NM_006717" in other vectors (7)

Reconstitution Protocol

Get a free Anti-DDK antibody sample free with this product. Use code: "DDK-Clone". View details »

USD 300.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


SPIN1 rabbit polyclonal antibody
    • 100 ul

USD 380.00

Other products for "spindlin 1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol spindlin 1
Synonyms SPIN; TDRD24
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC201938 representing NM_006717
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGACCCCATTCGGAAAGACACCTGGCCAGCGGTCCAGAGCTGATGCAGGCCATGCTGGAGTATCTG
CCAACATGATGAAGAAGAGGACATCCCACAAAAAACATCGGAGCAGTGTGGGTCCGAGCAAACCTGTTTC
CCAGCCCCGGCGGAACATCGTAGGCTGCAGGATTCAGCATGGGTGGAAAGAGGGGAATGGCCCTGTTACC
CAGTGGAAAGGAACCGTTCTGGACCAGGTGCCTGTAAATCCTTCTTTGTATCTTATAAAATACGATGGAT
TTGACTGTGTTTATGGACTAGAACTTAATAAAGATGAAAGAGTTTCTGCGCTTGAAGTCCTCCCTGATAG
AGTTGCGACATCTCGAATCAGCGATGCACACTTGGCAGACACAATGATTGGCAAAGCAGTGGAACATATG
TTTGAGACAGAGGATGGTTCTAAAGATGAGTGGAGGGGAATGGTCTTAGCACGTGCACCTGTCATGAACA
CATGGTTTTACATTACCTATGAGAAAGACCCTGTCTTGTACATGTACCAACTCTTAGATGATTACAAAGA
AGGCGACCTTCGCATTATGCCTGATTCCAATGATTCACCTCCAGCAGAAAGGGAACCAGGAGAAGTTGTG
GACAGCCTGGTAGGCAAACAAGTGGAATATGCCAAAGAAGATGGCTCGAAAAGGACTGGCATGGTCATTC
ATCAAGTAGAAGCCAAGCCCTCCGTCTATTTCATCAAGTTTGATGATGATTTCCATATTTATGTCTACGA
TTTGGTGAAAACATCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC201938 representing NM_006717
Red=Cloning site Green=Tags(s)

MKTPFGKTPGQRSRADAGHAGVSANMMKKRTSHKKHRSSVGPSKPVSQPRRNIVGCRIQHGWKEGNGPVT
QWKGTVLDQVPVNPSLYLIKYDGFDCVYGLELNKDERVSALEVLPDRVATSRISDAHLADTMIGKAVEHM
FETEDGSKDEWRGMVLARAPVMNTWFYITYEKDPVLYMYQLLDDYKEGDLRIMPDSNDSPPAEREPGEVV
DSLVGKQVEYAKEDGSKRTGMVIHQVEAKPSVYFIKFDDDFHIYVYDLVKTS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_006717
ORF Size 786 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_006717.3
RefSeq Size 4535 bp
RefSeq ORF 789 bp
Locus ID 10927
UniProt ID Q9Y657
Cytogenetics 9q22.1
Domains Spin-Ssty
MW 29.4 kDa
Gene Summary Chromatin reader that specifically recognizes and binds histone H3 both trimethylated at 'Lys-4' and asymmetrically dimethylated at 'Arg-8' (H3K4me3 and H3R8me2a) and acts as an activator of Wnt signaling pathway downstream of PRMT2. In case of cancer, promotes cell cancer proliferation via activation of the Wnt signaling pathway (PubMed:24589551). Overexpression induces metaphase arrest and chromosomal instability. Localizes to active rDNA loci and promotes the expression of rRNA genes (PubMed:21960006). May play a role in cell-cycle regulation during the transition from gamete to embryo. Involved in oocyte meiotic resumption, a process that takes place before ovulation to resume meiosis of oocytes blocked in prophase I: may act by regulating maternal transcripts to control meiotic resumption.[UniProtKB/Swiss-Prot Function]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.