DNAJC12 (NM_021800) Human Tagged ORF Clone

CAT#: RC201931

DNAJC12 (Myc-DDK-tagged)-Human DnaJ (Hsp40) homolog, subfamily C, member 12 (DNAJC12), transcript variant 1

Product images

Western blot validation of overexpression lysate (Cat# LY411920) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC201931 using transfection reagent MegaTran 2.0 (Cat# TT210002).

• 

  Coomassie blue staining of purified DNAJC12 protein (Cat# TP301931). The protein was produced from HEK293T cells transfected with DNAJC12 cDNA clone (Cat# RC201931) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: DNAJC12
• Synonyms: HPANBH4; JDP1
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC201931 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGATGCAATACTGAATTACAGGTCAGAAGATACTGAAGATTACTACACATTACTGGGATGTGATGAAC
  TATCTTCGGTTGAACAAATCCTGGCAGAATTTAAAGTCAGAGCTCTGGAATGTCACCCAGACAAGCATCC
  TGAAAACCCCAAAGCTGTGGAGACTTTTCAGAAACTGCAGAAGGCAAAGGAGATTCTGACCAATGAAGAG
  AGTCGAGCCCGCTATGACCACTGGCGAAGGAGCCAGATGTCGATGCCATTCCAGCAGTGGGAAGCTTTGA
  ATGACTCAGTGAAGACGTCAATGCACTGGGTTGTCAGAGGTAAAAAAGACCTGATGCTGGAAGAATCTGA
  CAAGACTCATACCACCAAGATGGAAAATGAGGAATGTAATGAGCAAAGAGAAAGAAAGAAAGAGGAGCTG
  GCTTCAACCGCAGAGAAAACGGAGCAGAAAGAACCCAAGCCCCTAGAGAAGTCAGTCTCCCCGCAAAATT
  CAGATTCTTCAGGTTTTGCAGATGTGAATGGTTGGCACCTTCGTTTCCGCTGGTCCAAGGATGCTCCCTC
  AGAACTCCTGAGGAAGTTCAGAAACTATGAAATA
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC201931 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDAILNYRSEDTEDYYTLLGCDELSSVEQILAEFKVRALECHPDKHPENPKAVETFQKLQKAKEILTNEE
  SRARYDHWRRSQMSMPFQQWEALNDSVKTSMHWVVRGKKDLMLEESDKTHTTKMENEECNEQRERKKEEL
  ASTAEKTEQKEPKPLEKSVSPQNSDSSGFADVNGWHLRFRWSKDAPSELLRKFRNYEI
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_021800
• ORF Size: 594 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_021800.3
• RefSeq Size: 1218 bp
• RefSeq ORF: 597 bp
• Locus ID: 56521
• UniProt ID: Q9UKB3
• Cytogenetics: 10q21.3
• Domains: DnaJ
• MW: 23.4 kDa
• Gene Summary: This gene encodes a member of a subclass of the HSP40/DnaJ protein family. Members of this family of proteins are associated with complex assembly, protein folding, and export. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008]