Calcium binding protein P22(CHP1) (NM_007236) Human Tagged ORF Clone

CAT#: RC201928

CHP1 (Myc-DDK-tagged)-Human calcium binding protein P22 (CHP)

Change vector?

USD 98

USD 390


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Calcium binding protein P22(CHP1) (NM_007236) Human Tagged ORF Clone
Symbol CHP1
Synonyms CHP; p22; p24; Sid470p; SLC9A1BP
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC201928 representing NM_007236
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGTTCTCGGGCCTCCACGTTACTGCGGGACGAAGAGCTCGAGGAGATCAAGAAGGAGACCGGCTTTT
CCCACAGTCAAATCACTCGCCTCTACAGCCGGTTCACCAGCCTGGACAAAGGAGAGAATGGGACTCTCAG
CCGGGAAGATTTCCAGAGGATTCCAGAACTTGCCATCAACCCACTGGGGGACCGGATCATCAATGCCTTC
TTTCCAGAGGGAGAGGACCAGGTAAACTTCCGTGGATTCATGCGAACTTTGGCTCATTTCCGCCCCATTG
AGGATAATGAAAAGAGCAAAGATGTGAATGGACCCGAACCACTCAACAGCCGAAGCAACAAACTGCACTT
TGCTTTTCGACTATATGATTTGGATAAAGATGAAAAGATCTCCCGTGATGAGCTGTTACAGGTGCTACGC
ATGATGGTCGGAGTAAATATCTCAGATGAGCAGCTGGGCAGCATCGCAGACAGGACCATTCAGGAGGCTG
ATCAGGATGGGGACAGTGCCATATCTTTCACAGAATTTGTTAAGGTTTTGGAGAAGGTGGATGTAGAACA
GAAAATGAGCATCCGATTTCTTCAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC201928 representing NM_007236
Red=Cloning site Green=Tags(s)

MGSRASTLLRDEELEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAINPLGDRIINAF
FPEGEDQVNFRGFMRTLAHFRPIEDNEKSKDVNGPEPLNSRSNKLHFAFRLYDLDKDEKISRDELLQVLR
MMVGVNISDEQLGSIADRTIQEADQDGDSAISFTEFVKVLEKVDVEQKMSIRFLH

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_007236
ORF Size 585 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_007236.1, NM_007236.2, NM_007236.3, NM_007236.4, NP_009167
RefSeq Size 3248
RefSeq ORF 588
Locus ID 11261
Cytogenetics 15q15.1
Domains EFh
Protein Pathways MAPK signaling pathway, Calcium signaling pathway, Oocyte meiosis, Apoptosis, Wnt signaling pathway, Axon guidance, VEGF signaling pathway, Natural killer cell mediated cytotoxicity, T cell receptor signaling pathway, B cell receptor signaling pathway, Long-term potentiation, Alzheimer's disease, Amyotrophic lateral sclerosis (ALS)
MW 22.3 kDa
Gene Summary This gene encodes a phosphoprotein that binds to the Na+/H+ exchanger NHE1. This protein serves as an essential cofactor which supports the physiological activity of NHE family members and may play a role in the mitogenic regulation of NHE1. The protein shares similarity with calcineurin B and calmodulin and it is also known to be an endogenous inhibitor of calcineurin activity. [provided by RefSeq, Jul 2008]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.