U1A(SNRPA) (NM_004596) Human Tagged ORF Clone

CAT#: RC201818

SNRPA (Myc-DDK-tagged)-Human small nuclear ribonucleoprotein polypeptide A (SNRPA)

Change vector?

USD 485


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name U1A(SNRPA) (NM_004596) Human Tagged ORF Clone
Symbol SNRPA
Synonyms Mud1; U1-A; U1A
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC201818 representing NM_004596
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCAGTTCCCGAGACCCGCCCTAACCACACTATTTATATCAACAACCTCAATGAGAAGATCAAGAAGG
ATGAGCTAAAAAAGTCCCTGTACGCCATCTTCTCCCAGTTTGGCCAGATCCTGGATATCCTGGTATCACG
GAGCCTGAAGATGAGGGGCCAGGCCTTTGTCATCTTCAAGGAGGTCAGCAGCGCCACCAACGCCCTGCGC
TCCATGCAGGGTTTCCCTTTCTATGACAAACCTATGCGTATCCAGTATGCCAAGACCGACTCAGATATCA
TTGCCAAGATGAAAGGCACCTTCGTGGAGCGGGACCGCAAGCGGGAGAAGAGGAAGCCCAAGAGCCAGGA
GACCCCGGCCACCAAGAAGGCTGTGCAAGGCGGGGGAGCCACCCCCGTGGTGGGGGCTGTCCAGGGGCCT
GTCCCGGGCATGCCGCCGATGACTCAGGCGCCCCGCATTATGCACCACATGCCGGGCCAGCCGCCCTACA
TGCCGCCCCCTGGTATGATCCCCCCGCCAGGCCTTGCACCTGGCCAGATCCCACCAGGGGCCATGCCCCC
GCAGCAGCTTATGCCAGGACAGATGCCCCCTGCCCAGCCTCTTTCTGAGAATCCACCGAATCACATCTTG
TTCCTCACCAACCTGCCAGAGGAGACCAACGAGCTCATGCTGTCCATGCTTTTCAATCAGTTCCCTGGCT
TCAAGGAGGTCCGTCTGGTACCCGGGCGGCATGACATCGCCTTCGTGGAGTTTGACAATGAGGTACAGGC
AGGGGCAGCTCGCGATGCCCTGCAGGGCTTTAAGATCACGCAGAACAACGCCATGAAGATCTCCTTTGCC
AAGAAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC201818 representing NM_004596
Red=Cloning site Green=Tags(s)

MAVPETRPNHTIYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLKMRGQAFVIFKEVSSATNALR
SMQGFPFYDKPMRIQYAKTDSDIIAKMKGTFVERDRKREKRKPKSQETPATKKAVQGGGATPVVGAVQGP
VPGMPPMTQAPRIMHHMPGQPPYMPPPGMIPPPGLAPGQIPPGAMPPQQLMPGQMPPAQPLSENPPNHIL
FLTNLPEETNELMLSMLFNQFPGFKEVRLVPGRHDIAFVEFDNEVQAGAARDALQGFKITQNNAMKISFA
KK

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_004596
ORF Size 846 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_004596.1, NM_004596.2, NM_004596.3, NM_004596.4, NP_004587
RefSeq Size 1626
RefSeq ORF 849
Locus ID 6626
Cytogenetics 19q13.2
Domains rrm
Protein Families Stem cell - Pluripotency
Protein Pathways Spliceosome
MW 31.1 kDa
Gene Summary The protein encoded by this gene associates with stem loop II of the U1 small nuclear ribonucleoprotein, which binds the 5' splice site of precursor mRNAs and is required for splicing. The encoded protein autoregulates itself by polyadenylation inhibition of its own pre-mRNA via dimerization and has been implicated in the coupling of splicing and polyadenylation. [provided by RefSeq, Oct 2010]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.