alpha 1 Catenin(CTNNA1) (NM_001903) Human Tagged ORF Clone

CAT#: RC201766

CTNNA1 (Myc-DDK-tagged)-Human catenin (cadherin-associated protein), alpha 1, 102kDa (CTNNA1)

Change vector?

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name alpha 1 Catenin(CTNNA1) (NM_001903) Human Tagged ORF Clone
Symbol CTNNA1
Synonyms CAP102; MDPT2
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC201766 representing NM_001903
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACTGCTGTCCATGCAGGCAACATAAACTTCAAGTGGGATCCTAAAAGTCTAGAGATCAGGACTCTGG
CAGTTGAGAGACTGTTGGAGCCTCTTGTTACACAGGTTACAACCCTTGTAAACACCAATAGTAAAGGGCC
CTCTAATAAGAAGAGAGGTCGTTCTAAGAAGGCCCATGTTTTGGCTGCATCTGTTGAACAAGCAACTGAG
AATTTCTTGGAGAAGGGGGATAAAATTGCGAAGGAGAGCCAGTTTCTCAAGGAGGAGCTTGTGGCTGCTG
TAGAAGATGTTCGAAAACAAGGTGATTTGATGAAGGCTGCTGCAGGAGAGTTCGCAGATGATCCCTGCTC
TTCTGTGAAGCGAGGCAACATGGTTCGGGCAGCTCGAGCTTTGCTCTCTGCTGTTACCCGGTTGCTGATT
TTGGCTGACATGGCAGATGTCTACAAATTACTTGTTCAGCTGAAAGTTGTGGAAGATGGTATCTTGAAGT
TGAGGAATGCTGGCAATGAACAAGACTTAGGAATCCAGTATAAAGCCCTAAAACCTGAAGTGGATAAGCT
GAACATTATGGCAGCCAAAAGACAACAGGAATTGAAAGATGTTGGCCATCGTGATCAGATGGCTGCAGCT
AGAGGAATCCTGCAGAAGAACGTTCCGATCCTCTATACTGCATCCCAGGCATGCCTACAGCACCCTGATG
TCGCAGCCTATAAGGCCAACAGGGACCTGATATACAAGCAGCTGCAGCAGGCGGTCACAGGCATTTCCAA
TGCAGCCCAGGCCACTGCCTCAGACGATGCCTCACAGCACCAGGGTGGAGGAGGAGGAGAACTGGCATAT
GCACTCAATAACTTTGACAAACAAATCATTGTGGACCCCTTGAGCTTCAGCGAGGAGCGCTTTAGGCCTT
CCCTGGAGGAGCGTCTGGAAAGCATCATTAGTGGGGCTGCCTTGATGGCCGACTCGTCCTGCACGCGTGA
TGACCGTCGTGAGCGAATTGTGGCAGAGTGTAATGCTGTCCGCCAGGCCCTGCAGGACCTGCTTTCGGAG
TACATGGGCAATGCTGGACGTAAAGAAAGAAGTGATGCACTCAATTCTGCAATAGATAAAATGACCAAGA
AGACCAGGGACTTGCGTAGACAGCTCCGCAAAGCTGTCATGGACCACGTTTCAGATTCTTTCCTGGAAAC
CAATGTTCCACTTTTGGTATTGATTGAAGCTGCAAAGAATGGAAATGAGAAAGAAGTTAAGGAGTATGCC
CAAGTTTTCCGTGAACATGCCAACAAATTGATTGAGGTTGCCAACTTGGCCTGTTCCATCTCAAATAATG
AAGAAGGTGTAAAGCTTGTTCGAATGTCTGCAAGCCAGTTAGAAGCCCTCTGTCCTCAGGTTATTAATGC
TGCACTGGCTTTAGCAGCAAAACCACAGAGTAAACTGGCCCAAGAGAACATGGATCTTTTTAAAGAACAA
TGGGAAAAACAAGTCCGTGTTCTCACAGATGCTGTCGATGACATTACTTCCATTGATGACTTCTTGGCTG
TCTCAGAGAATCACATTTTGGAAGATGTGAACAAATGTGTCATTGCTCTCCAAGAGAAGGATGTGGATGG
CCTGGACCGCACAGCTGGTGCAATTCGAGGCCGGGCAGCCCGGGTCATTCACGTAGTCACCTCAGAGATG
GACAACTATGAGCCAGGAGTCTACACAGAGAAGGTTCTGGAAGCCACTAAGCTGCTCTCCAACACAGTCA
TGCCACGTTTTACTGAGCAAGTAGAAGCAGCCGTGGAAGCCCTCAGCTCGGACCCTGCCCAGCCCATGGA
TGAGAATGAGTTTATCGATGCTTCCCGCCTGGTATATGATGGCATCCGGGACATCAGGAAAGCAGTGCTG
ATGATAAGGACCCCTGAGGAGTTGGATGACTCTGACTTTGAGACAGAAGATTTTGATGTCAGAAGCAGGA
CGAGCGTCCAGACAGAAGACGATCAGCTGATAGCTGGCCAGAGTGCCCGGGCGATCATGGCTCAGCTTCC
CCAGGAGCAAAAAGCGAAGATTGCGGAACAGGTGGCCAGCTTCCAGGAAGAAAAGAGCAAGCTGGATGCT
GAAGTGTCCAAATGGGACGACAGTGGCAATGACATCATTGTGCTGGCCAAGCAGATGTGCATGATTATGA
TGGAGATGACAGACTTTACCCGAGGTAAAGGACCACTCAAAAATACATCGGATGTCATCAGTGCTGCCAA
GAAAATTGCTGAGGCAGGATCCAGGATGGACAAGCTTGGCCGCACCATTGCAGACCATTGCCCCGACTCG
GCTTGCAAGCAGGACCTGCTGGCCTACCTGCAACGCATCGCCCTCTACTGCCACCAGCTGAACATCTGCA
GCAAGGTCAAGGCCGAGGTGCAGAATCTCGGCGGGGAGCTTGTTGTCTCTGGGGTGGACAGCGCCATGTC
CCTGATCCAGGCAGCCAAGAACTTGATGAATGCTGTGGTGCAGACAGTGAAGGCATCCTACGTCGCCTCT
ACCAAATACCAAAAGTCACAGGGTATGGCTTCCCTCAACCTTCCTGCTGTGTCATGGAAGATGAAGGCAC
CAGAGAAAAAGCCATTGGTGAAGAGAGAGAAACAGGATGAGACACAGACCAAGATTAAACGGGCATCTCA
GAAGAAGCACGTGAACCCGGTGCAGGCCCTCAGCGAGTTCAAAGCTATGGACAGCATC


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC201766 representing NM_001903
Red=Cloning site Green=Tags(s)

MTAVHAGNINFKWDPKSLEIRTLAVERLLEPLVTQVTTLVNTNSKGPSNKKRGRSKKAHVLAASVEQATE
NFLEKGDKIAKESQFLKEELVAAVEDVRKQGDLMKAAAGEFADDPCSSVKRGNMVRAARALLSAVTRLLI
LADMADVYKLLVQLKVVEDGILKLRNAGNEQDLGIQYKALKPEVDKLNIMAAKRQQELKDVGHRDQMAAA
RGILQKNVPILYTASQACLQHPDVAAYKANRDLIYKQLQQAVTGISNAAQATASDDASQHQGGGGGELAY
ALNNFDKQIIVDPLSFSEERFRPSLEERLESIISGAALMADSSCTRDDRRERIVAECNAVRQALQDLLSE
YMGNAGRKERSDALNSAIDKMTKKTRDLRRQLRKAVMDHVSDSFLETNVPLLVLIEAAKNGNEKEVKEYA
QVFREHANKLIEVANLACSISNNEEGVKLVRMSASQLEALCPQVINAALALAAKPQSKLAQENMDLFKEQ
WEKQVRVLTDAVDDITSIDDFLAVSENHILEDVNKCVIALQEKDVDGLDRTAGAIRGRAARVIHVVTSEM
DNYEPGVYTEKVLEATKLLSNTVMPRFTEQVEAAVEALSSDPAQPMDENEFIDASRLVYDGIRDIRKAVL
MIRTPEELDDSDFETEDFDVRSRTSVQTEDDQLIAGQSARAIMAQLPQEQKAKIAEQVASFQEEKSKLDA
EVSKWDDSGNDIIVLAKQMCMIMMEMTDFTRGKGPLKNTSDVISAAKKIAEAGSRMDKLGRTIADHCPDS
ACKQDLLAYLQRIALYCHQLNICSKVKAEVQNLGGELVVSGVDSAMSLIQAAKNLMNAVVQTVKASYVAS
TKYQKSQGMASLNLPAVSWKMKAPEKKPLVKREKQDETQTKIKRASQKKHVNPVQALSEFKAMDSI

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms CHROMATOGRAMS
Restriction Sites SgfI-RsrII      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001903
ORF Size 2718 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001903.2, NM_001903.3, NM_001903.4, NP_001894
RefSeq Size 3778
Locus ID 1495
Cytogenetics 5q31.2
Domains Vinculin
Protein Families Druggable Genome
Protein Pathways Adherens junction, Tight junction, Leukocyte transendothelial migration, Pathways in cancer, Endometrial cancer, Arrhythmogenic right ventricular cardiomyopathy (ARVC)
MW 99.9 kDa
Gene Summary This gene encodes a member of the catenin family of proteins that play an important role in cell adhesion process by connecting cadherins located on the plasma membrane to the actin filaments inside the cell. The encoded mechanosensing protein contains three vinculin homology domains and undergoes conformational changes in response to cytoskeletal tension, resulting in the reconfiguration of cadherin-actin filament connections. Certain mutations in this gene cause butterfly-shaped pigment dystrophy. [provided by RefSeq, May 2016].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.