GPR162(GPR162) (NM_014449) Human Tagged ORF Clone

CAT#: RC201764

GPR162 (Myc-DDK-tagged)-Human G protein-coupled receptor 162 (GPR162), transcript variant A-1

Change vector?

USD 485


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name GPR162(GPR162) (NM_014449) Human Tagged ORF Clone
Symbol GPR162
Synonyms A-2; GRCA
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC201764 representing NM_014449
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTGAGCACTGGGGTGGTGAGCTTCTTCTCCCTCAAGTCGGACTCGGCGCCCCCCTGGATGGTGCTGG
CTGTGCTGTGGTGCTCCATGGCACAGACGCTGCTGCTGCCCTCCTTCATCTGGTCCTGCGAGCGCTACCG
CGCCGACGTGCGCACAGTGTGGGAGCAATGCGTGGCCATCATGTCTGAGGAGGATGGAGATGACGATGGG
GGCTGTGACGACTATGCAGAGGGCCGAGTTTGCAAAGTTCGCTTTGATGCTAACGGAGCCACAGGACCAG
GGAGCCGGGACCCCGCCCAGGTGAAGCTGCTGCCTGGAAGGCACATGCTCTTCCCTCCTCTTGAGAGAGT
CCACTACTTACAGGTCCCCCTATCCCGGCGTCTGTCCCATGATGAGACAAACATCTTCTCTACCCCTCGG
GAACCAGGCTCCTTCCTGCACAAGTGGTCATCCTCTGATGACATCCGGGTCCTCCCAGCCCAGAGCCGGG
CCCTCGGGGGTCCTCCTGAGTACCTGGGACAAAGACACAGGTTGGAGGACGAGGAGGACGAGGAAGAGGC
TGAAGGTGGGGGGCTGGCCAGCCTTCGCCAATTCTTGGAGAGTGGGGTTCTGGGGTCAGGTGGGGGACCC
CCACGGGGTCCTGGCTTCTTCCGGGAGGAGATCACCACCTTCATCGATGAGACACCTCTGCCTTCTCCGA
CTGCCTCACCAGGGCACTCTCCTCGTCGGCCCCGGCCACTGGGCCTCTCACCCCGCCGACTCTCCCTTGG
GTCCCCTGAGAGCAGAGCCGTTGGACTTCCTTTGGGACTAAGCGCAGGGAGACGCTGCTCCCTGACGGGG
GGTGAAGAAAGTGCAAGGGCTTGGGGAGGATCCTGGGGCCCAGGCAACCCCATCTTTCCCCAGCTGACCC
TG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC201764 representing NM_014449
Red=Cloning site Green=Tags(s)

MLSTGVVSFFSLKSDSAPPWMVLAVLWCSMAQTLLLPSFIWSCERYRADVRTVWEQCVAIMSEEDGDDDG
GCDDYAEGRVCKVRFDANGATGPGSRDPAQVKLLPGRHMLFPPLERVHYLQVPLSRRLSHDETNIFSTPR
EPGSFLHKWSSSDDIRVLPAQSRALGGPPEYLGQRHRLEDEEDEEEAEGGGLASLRQFLESGVLGSGGGP
PRGPGFFREEITTFIDETPLPSPTASPGHSPRRPRPLGLSPRRLSLGSPESRAVGLPLGLSAGRRCSLTG
GEESARAWGGSWGPGNPIFPQLTL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_014449
ORF Size 912 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_014449.1, NP_055264
RefSeq Size 1514
RefSeq ORF 915
Locus ID 27239
Cytogenetics 12p13.31
Protein Families GPCR, Transmembrane, Druggable Genome
MW 32.9 kDa
Gene Summary This gene was identified upon genomic analysis of a gene-dense region at human chromosome 12p13. It appears to be mainly expressed in the brain; however, its function is not known. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.