GC1q R(C1QBP) (NM_001212) Human Tagged ORF Clone

CAT#: RC201742

C1QBP (Myc-DDK-tagged)-Human complement component 1, q subcomponent binding protein (C1QBP), nuclear gene encoding mitochondrial protein

  • TrueORF®

Need custom modification / cloning service?
Get a free quote

USD 505.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name GC1q R(C1QBP) (NM_001212) Human Tagged ORF Clone
Symbol C1QBP
Synonyms gC1Q-R; GC1QBP; gC1qR; HABP1; p32; SF2p32
Vector pCMV6-Entry
Sequence Data
>RC201742 representing NM_001212
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTGCCTCTGCTGCGCTGCGTGCCCCGTGTGCTGGGCTCCTCCGTCGCCGGCCTCCGCGCTGCCGCGC
CCGCCTCGCCTTTCCGGCAGCTCCTGCAGCCGGCACCCCGGCTGTGCACCCGGCCCTTCGGGCTGCTCAG
CGTGCGCGCAGGTTCCGAGCGGCGGCCGGGCCTCCTGCGGCCTCGCGGACCCTGCGCCTGTGGCTGTGGC
TGCGGCTCGCTGCACACCGACGGAGACAAAGCTTTTGTTGATTTCCTGAGTGATGAAATTAAGGAGGAAA
GAAAAATTCAGAAGCATAAAACCCTCCCTAAGATGTCTGGAGGTTGGGAGCTGGAACTGAATGGGACAGA
AGCGAAATTAGTGCGGAAAGTTGCCGGGGAAAAAATCACGGTCACTTTCAACATTAACAACAGCATCCCA
CCAACATTTGATGGTGAGGAGGAACCCTCGCAAGGGCAGAAGGTTGAAGAACAGGAGCCTGAACTGACAT
CAACTCCCAATTTCGTGGTTGAAGTTATAAAGAATGATGATGGCAAGAAGGCCCTTGTGTTGGACTGTCA
TTATCCAGAGGATGAGGTTGGACAAGAAGACGAGGCTGAGAGTGACATCTTCTCTATCAGGGAAGTTAGC
TTTCAGTCCACTGGCGAGTCTGAATGGAAGGATACTAATTATACACTCAACACAGATTCCTTGGACTGGG
CCTTATATGACCACCTAATGGATTTCCTTGCCGACCGAGGGGTGGACAACACTTTTGCAGATGAGCTGGT
GGAGCTCAGCACAGCCCTGGAGCACCAGGAGTACATTACTTTTCTTGAAGACCTCAAGAGTTTTGTCAAG
AGCCAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC201742 representing NM_001212
Red=Cloning site Green=Tags(s)

MLPLLRCVPRVLGSSVAGLRAAAPASPFRQLLQPAPRLCTRPFGLLSVRAGSERRPGLLRPRGPCACGCG
CGSLHTDGDKAFVDFLSDEIKEERKIQKHKTLPKMSGGWELELNGTEAKLVRKVAGEKITVTFNINNSIP
PTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHYPEDEVGQEDEAESDIFSIREVS
FQSTGESEWKDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQEYITFLEDLKSFVK
SQ

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001212
ORF Size 846 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001212.1, NM_001212.2, NM_001212.3, NP_001203
RefSeq Size 1163
RefSeq ORF 849
Locus ID 708
Cytogenetics 17p13.2
Domains MAM33
MW 31.36 kDa
Gene Summary The human complement subcomponent C1q associates with C1r and C1s in order to yield the first component of the serum complement system. The protein encoded by this gene is known to bind to the globular heads of C1q molecules and inhibit C1 activation. This protein has also been identified as the p32 subunit of pre-mRNA splicing factor SF2, as well as a hyaluronic acid-binding protein. [provided by RefSeq, Jul 2008]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)