PRMT7 (NM_019023) Human Tagged ORF Clone

CAT#: RC201672

Reviews ()
Write a review

PRMT7 (Myc-DDK-tagged)-Human protein arginine methyltransferase 7 (PRMT7), transcript variant 1



Reconstitution Protocol

USD 950.00

In Stock*

Size
    • 10 ug

Product images

Other products for "PRMT7"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol PRMT7
Synonyms SBIDDS
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC201672 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGATCTTCTGCAGTCGGGCCAATCCGACCACGGGGTCTGTGGAGTGGCTGGAGGAGGATGAACACT
ATGATTACCACCAGGAGATTGCAAGGTCATCTTATGCAGATATGCTACATGACAAAGACAGAAATGTAAA
ATACTACCAAGGTATCCGGGCTGCCGTGAGCAGGGTGAAGGACAGAGGACAGAAGGCCTTGGTTCTCGAC
ATTGGCACTGGCACGGGACTCTTGTCAATGATGGCGGTCACAGCAGGTGCCGACTTCTGCTATGCCATCG
AGGTTTTCAAGCCTATGGCTGATGCTGCTGTGAAGATTGTGGAGAAAAATGGCTTTAGTGATAAGATTAA
GGTTATCAACAAGCATTCCACCGAGGTGACTGTAGGTCCAGAGGGTGACATGCCATGCCGTGCCAACATC
CTGGTCACAGAGTTGTTTGACACAGAGCTGATCGGGGAGGGGGCGCTGCCCTCCTATGAGCACGCACACA
GGCATCTCGTGGAGGAAAATTGTGAGGCCGTGCCCCACAGAGCCACCGTCTATGCACAGCTGGTGGAGTC
CGGGAGGATGTGGTCGTGGAACAAGCTATTTCCCATCCACGTGCAGACCAGCCTCGGAGAGCAGGTCATC
GTCCCTCCCGTTGACGTGGAGAGCTGCCCTGGCGCACCCTCTGTCTGTGACATTCAGCTGAACCAGGTGT
CACCAGCCGACTTTACAGTCCTCAGCGATGTGCTGCCCATGTTCAGCATAGACTTCAGCAAGCAAGTCAG
TAGCTCAGCAGCCTGCCATAGCAGGCGGTTTGAACCTCTGACATCTGGCCGAGCTCAGGTGGTTCTCTCG
TGGTGGGACATTGAAATGGACCCTGAGGGGAAGATCAAGTGCACCATGGCCCCCTTCTGGGCACACTCAG
ACCCAGAGGAGATGCAGTGGCGGGACCACTGGATGCAGTGTGTGTACTTCCTGCCACAAGAGGAGCCTGT
GGTGCAGGGCTCAGCGCTCTATCTGGTAGCCCACCACGATGACTACTGCGTATGGTACAGCCTGCAGAGG
ACCAGCCCTGAAAAGAATGAGAGAGTCCGCCAGATGCGCCCCGTGTGTGACTGCCAGGCTCACCTGCTCT
GGAACCGGCCTCGGTTTGGAGAGATCAATGACCAGGACAGAACTGATCGATACGTCCAGGCTCTGAGGAC
CGTGCTGAAGCCAGACAGCGTGTGCCTGTGTGTCAGCGATGGCAGCCTGCTCTCCGTGCTGGCCCATCAC
CTGGGGGTGGAGCAGGTGTTTACAGTCGAGAGTTCAGCAGCTTCTCACAAACTGTTGAGAAAAATCTTCA
AGGCTAACCACTTGGAAGATAAAATTAACATCATAGAGAAACGGCCGGAATTATTAACAAATGAGGACCT
ACAGGGCAGAAAGGTCTCTCTCCTCCTGGGCGAGCCGTTCTTCACTACCAGCCTGCTGCCGTGGCACAAC
CTCTACTTCTGGTACGTGCGGACCGCTGTGGACCAGCACCTGGGGCCAGGTGCCATGGTGATGCCCCAGG
CAGCCTCGCTGCACGCTGTGGTTGTGGAGTTCAGGGACCTGTGGCGGATCCGGAGCCCCTGTGGTGACTG
CGAAGGCTTCGACGTGCACATCATGGACGACATGATTAAGCGTGCCCTGGACTTCAGGGAGAGCAGGGAA
GCTGAGCCCCACCCGCTGTGGGAGTACCCATGCCGCAGCCTCTCCGAGCCCTGGCAGATCCTGACCTTTG
ACTTCCAGCAGCCGGTGCCCCTGCAGCCCCTGTGTGCCGAGGGCACTGTGGAGCTCAGAAGGCCCGGGCA
GAGCCACGCAGCGGTGCTATGGATGGAGTACCACCTGACCCCGGAGTGCACGCTCAGCACTGGCCTCCTG
GAGCCTGCAGACCCCGAGGGGGGCTGCTGCTGGAACCCCCACTGCAAGCAGGCCGTCTACTTCTTCAGCC
CTGCCCCAGATCCCAGAGCACTGCTGGGTGGCCCACGGACTGTCAGCTATGCAGTGGAGTTTCACCCCGA
CACAGGCGACATCATCATGGAGTTCAGGCATGCAGATACCCCAGAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC201672 protein sequence
Red=Cloning site Green=Tags(s)

MKIFCSRANPTTGSVEWLEEDEHYDYHQEIARSSYADMLHDKDRNVKYYQGIRAAVSRVKDRGQKALVLD
IGTGTGLLSMMAVTAGADFCYAIEVFKPMADAAVKIVEKNGFSDKIKVINKHSTEVTVGPEGDMPCRANI
LVTELFDTELIGEGALPSYEHAHRHLVEENCEAVPHRATVYAQLVESGRMWSWNKLFPIHVQTSLGEQVI
VPPVDVESCPGAPSVCDIQLNQVSPADFTVLSDVLPMFSIDFSKQVSSSAACHSRRFEPLTSGRAQVVLS
WWDIEMDPEGKIKCTMAPFWAHSDPEEMQWRDHWMQCVYFLPQEEPVVQGSALYLVAHHDDYCVWYSLQR
TSPEKNERVRQMRPVCDCQAHLLWNRPRFGEINDQDRTDRYVQALRTVLKPDSVCLCVSDGSLLSVLAHH
LGVEQVFTVESSAASHKLLRKIFKANHLEDKINIIEKRPELLTNEDLQGRKVSLLLGEPFFTTSLLPWHN
LYFWYVRTAVDQHLGPGAMVMPQAASLHAVVVEFRDLWRIRSPCGDCEGFDVHIMDDMIKRALDFRESRE
AEPHPLWEYPCRSLSEPWQILTFDFQQPVPLQPLCAEGTVELRRPGQSHAAVLWMEYHLTPECTLSTGLL
EPADPEGGCCWNPHCKQAVYFFSPAPDPRALLGGPRTVSYAVEFHPDTGDIIMEFRHADTPD

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_019023
ORF Size 2076 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_019023.5
RefSeq Size 2478 bp
RefSeq ORF 2079 bp
Locus ID 54496
UniProt ID Q9NVM4
Cytogenetics 16q22.1
Protein Families Druggable Genome
MW 78.5 kDa
Gene Summary This gene encodes a member of the protein arginine N-methyltransferase family of proteins. The encoded enzyme transfers single methyl groups to arginine residues to generate monomethylarginines on histone proteins as well as other protein substrates. This enzyme plays a role in a wide range of biological processes, including neuronal differentiation, male germ line imprinting, small nuclear ribonucleoprotein biogenesis, and regulation of the Wnt signaling pathway. Mutations in this gene underlie multiple related syndromes in human patients characterized by intellectual disability, short stature and other features. The encoded protein may promote breast cancer cell invasion and metastasis in human patients. [provided by RefSeq, May 2017]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.