Beclin 1(BECN1) (NM_003766) Human Tagged ORF Clone

CAT#: RC201629

BECN1 (Myc-DDK-tagged)-Human beclin 1, autophagy related (BECN1)

Clone Modification / Custom Cloning Service

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Beclin 1(BECN1) (NM_003766) Human Tagged ORF Clone
Symbol BECN1
Synonyms ATG6; beclin1; VPS30
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC201629 representing NM_003766
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAAGGGTCTAAGACGTCCAACAACAGCACCATGCAGGTGAGCTTCGTGTGCCAGCGCTGCAGCCAGC
CCCTGAAACTGGACACGAGTTTCAAGATCCTGGACCGTGTCACCATCCAGGAACTCACAGCTCCATTACT
TACCACAGCCCAGGCGAAACCAGGAGAGACCCAGGAGGAAGAGACTAACTCAGGAGAGGAGCCATTTATT
GAAACTCCTCGCCAGGATGGTGTCTCTCGCAGATTCATCCCCCCAGCCAGGATGATGTCCACAGAAAGTG
CCAACAGCTTCACTCTGATTGGGGAGGCATCTGATGGCGGCACCATGGAGAACCTCAGCCGAAGACTGAA
GGTCACTGGGGACCTTTTTGACATCATGTCGGGCCAGACAGATGTGGATCACCCACTCTGTGAGGAATGC
ACAGATACTCTTTTAGACCAGCTGGACACTCAGCTCAACGTCACTGAAAATGAGTGTCAGAACTACAAAC
GCTGTTTGGAGATCTTAGAGCAAATGAATGAGGATGACAGTGAACAGTTACAGATGGAGCTAAAGGAGCT
GGCACTAGAGGAGGAGAGGCTGATCCAGGAGCTGGAAGACGTGGAAAAGAACCGCAAGATAGTGGCAGAA
AATCTCGAGAAGGTCCAGGCTGAGGCTGAGAGACTGGATCAGGAGGAAGCTCAGTATCAGAGAGAATACA
GTGAATTTAAACGACAGCAGCTGGAGCTGGATGATGAGCTGAAGAGTGTTGAAAACCAGATGCGTTATGC
CCAGACGCAGCTGGATAAGCTGAAGAAAACCAACGTCTTTAATGCAACCTTCCACATCTGGCACAGTGGA
CAGTTTGGCACAATCAATAACTTCAGGCTGGGTCGCCTGCCCAGTGTTCCCGTGGAATGGAATGAGATTA
ATGCTGCTTGGGGCCAGACTGTGTTGCTGCTCCATGCTCTGGCCAATAAGATGGGTCTGAAATTTCAGAG
ATACCGACTTGTTCCTTACGGAAACCATTCATATCTGGAGTCTCTGACAGACAAATCTAAGGAGCTGCCG
TTATACTGTTCTGGGGGGTTGCGGTTTTTCTGGGACAACAAGTTTGACCATGCAATGGTGGCTTTCCTGG
ACTGTGTGCAGCAGTTCAAAGAAGAGGTTGAGAAAGGCGAGACACGTTTTTGTCTTCCCTACAGGATGGA
TGTGGAGAAAGGCAAGATTGAAGACACAGGAGGCAGTGGCGGCTCCTATTCCATCAAAACCCAGTTTAAC
TCTGAGGAGCAGTGGACAAAAGCTCTCAAGTTCATGCTGACGAATCTTAAGTGGGGTCTTGCTTGGGTGT
CCTCACAATTTTATAACAAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC201629 representing NM_003766
Red=Cloning site Green=Tags(s)

MEGSKTSNNSTMQVSFVCQRCSQPLKLDTSFKILDRVTIQELTAPLLTTAQAKPGETQEEETNSGEEPFI
ETPRQDGVSRRFIPPARMMSTESANSFTLIGEASDGGTMENLSRRLKVTGDLFDIMSGQTDVDHPLCEEC
TDTLLDQLDTQLNVTENECQNYKRCLEILEQMNEDDSEQLQMELKELALEEERLIQELEDVEKNRKIVAE
NLEKVQAEAERLDQEEAQYQREYSEFKRQQLELDDELKSVENQMRYAQTQLDKLKKTNVFNATFHIWHSG
QFGTINNFRLGRLPSVPVEWNEINAAWGQTVLLLHALANKMGLKFQRYRLVPYGNHSYLESLTDKSKELP
LYCSGGLRFFWDNKFDHAMVAFLDCVQQFKEEVEKGETRFCLPYRMDVEKGKIEDTGGSGGSYSIKTQFN
SEEQWTKALKFMLTNLKWGLAWVSSQFYNK

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_003766
ORF Size 1350 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_003766.1, NM_003766.2, NM_003766.3, NM_003766.4, NP_003757
RefSeq Size 2144
RefSeq ORF 1353
Locus ID 8678
Cytogenetics 17q21.31
Domains APG6
Protein Families Druggable Genome
Protein Pathways Regulation of autophagy
MW 51.7 kDa
Gene Summary This gene encodes a protein that regulates autophagy, a catabolic process of degradation induced by starvation. The encoded protein is a component of the phosphatidylinositol-3-kinase (PI3K) complex which mediates vesicle-trafficking processes. This protein is thought to play a role in multiple cellular processes, including tumorigenesis, neurodegeneration and apoptosis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2015]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)