hnRNP U(HNRNPU) (NM_004501) Human Tagged ORF Clone

CAT#: RC201627

HNRNPU (Myc-DDK-tagged)-Human heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A) (HNRNPU), transcript variant 2

Need custom modification / cloning service?
Get a free quote

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name hnRNP U(HNRNPU) (NM_004501) Human Tagged ORF Clone
Symbol HNRNPU
Synonyms hnRNP U; HNRNPU-AS1; HNRPU; SAF-A; SAFA; U21.1
Vector pCMV6-Entry
Sequence Data
>RC201627 representing NM_004501
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGTTCCTCGCCTGTTAATGTAAAAAAGCTGAAGGTGTCGGAGCTGAAAGAGGAGCTCAAGAAGCGAC
GCCTTTCTGACAAGGGTCTCAAGGCCGAGCTCATGGAGCGACTCCAGGCTGCGCTGGACGACGAGGAGGC
CGGGGGCCGCCCCGCCATGGAGCCCGGGAACGGCAGCCTAGACCTGGGCGGGGATTCCGCTGGGCGCTCG
GGAGCAGGCCTCGAGCAGGAGGCCGCGGCCGGCGGCGATGAAGAGGAGGAGGAAGAGGAAGAGGAGGAGG
AAGGAATCTCCGCTCTGGACGGCGACCAGATGGAGCTAGGAGAGGAGAACGGGGCCGCGGGGGCGGCCGA
CTCGGGCCCGATGGAGGAGGAGGAGGCCGCCTCGGAAGACGAGAACGGCGACGATCAGGGTTTCCAGGAA
GGGGAAGATGAGCTCGGGGACGAAGAGGAAGGCGCGGGCGACGAGAACGGGCACGGGGAGCAGCAGCCTC
AACCGCCGGCGACGCAGCAGCAACAGCCCCAACAGCAGCGCGGGGCCGCCAAGGAGGCCGCGGGGAAGAG
CAGCGGCCCCACCTCGCTGTTCGCGGTGACGGTGGCGCCGCCCGGGGCGAGGCAGGGCCAGCAGCAGGCG
GGAGGGGACGGCAAAACAGAACAGAAAGGCGGAGATAAAAAGAGGGGTGTTAAAAGACCACGAGAAGATC
ATGGCCGTGGATATTTTGAGTACATTGAAGAGAACAAGTATAGCAGAGCCAAATCTCCTCAGCCACCTGT
TGAAGAAGAAGATGAACACTTCGATGACACAGTGGTTTGTCTTGATACTTATAATTGTGATCTACATTTT
AAAATATCAAGAGATCGTCTCAGTGCTTCTTCCCTTACAATGGAGAGTTTTGCTTTTCTTTGGGCTGGAG
GAAGAGCATCCTATGGTGTGTCAAAAGGCAAAGTGTGTTTTGAGATGAAGGTTACAGAGAAGATCCCAGT
AAGGCATTTATATACAAAAGATATTGACATACATGAAGTTCGTATTGGCTGGTCACTAACTACAAGTGGA
ATGTTACTTGGTGAAGAAGAATTTTCTTATGGGTATTCTCTAAAAGGAATAAAAACATGCAACTGTGAGA
CTGAAGATTATGGAGAAAAGTTTGATGAAAATGATGTGATTACATGTTTTGCTAACTTTGAAAGTGATGA
AGTAGAACTCTCGTATGCTAAGAATGGACAAGATCTTGGCGTTGCCTTCAAAATCAGTAAGGAAGTTCTT
GCTGGACGGCCACTGTTCCCGCATGTTCTCTGCCACAACTGTGCAGTTGAATTTAATTTTGGTCAGAAGG
AAAAGCCATATTTTCCAATACCTGAAGAGTATACTTTCATCCAGAACGTCCCCTTAGAGGATCGAGTTAG
AGGACCAAAGGGGCCTGAAGAGAAGAAAGATTGTGAAGTTGTGATGATGATTGGCTTGCCAGGAGCTGGA
AAAACTACCTGGGTTACTAAACATGCAGCAGAAAATCCAGGGAAATATAACATTCTTGGCACAAATACTA
TTATGGATAAGATGATGGTGGCAGGTTTTAAGAAGCAAATGGCAGATACTGGAAAACTGAACACACTGTT
GCAGAGAGCCCCCCAGTGTCTTGGGAAATTTATTGAGATTGCTGCCCGAAAGAAGCGAAATTTTATTCTG
GATCAGACAAATGTGTCTGCTGCTGCCCAGAGGAGAAAAATGTGCCTGTTTGCAGGCTTCCAGCGAAAAG
CTGTTGTAGTTTGCCCAAAAGATGAAGACTATAAGCAAAGAACACAGAAGAAAGCAGAAGTAGAGGGGAA
AGACCTACCAGAACATGCGGTCCTCAAAATGAAAGGAAACTTTACCCTCCCAGAGGTAGCTGAGTGCTTT
GATGAAATAACCTATGTTGAACTTCAGAAGGAAGAAGCCCAAAAACTCTTGGAGCAATATAAGGAAGAAA
GCAAAAAGGCTCTTCCACCAGAAAAGAAACAGAACACTGGCTCAAAGAAAAGCAATAAAAATAAGAGTGG
CAAGAACCAGTTTAACAGAGGTGGTGGCCATAGAGGACGTGGAGGATTCAATATGCGTGGTGGAAATTTC
AGAGGAGGAGCCCCTGGGAATCGTGGCGGATATAATAGGAGGGGCAACATGCCACAGAGAGGTGGTGGCG
GTGGAGGAAGTGGTGGAATCGGCTATCCATACCCTCGTGCCCCTGTTTTTCCTGGCCGTGGTAGTTACTC
AAACAGAGGGAACTACAACAGAGGTGGAATGCCCAACAGAGGGAACTACAACCAGAACTTCAGAGGACGA
GGAAACAATCGTGGCTACAAAAATCAATCTCAGGGCTACAACCAGTGGCAGCAGGGTCAATTCTGGGGTC
AGAAGCCATGGAGTCAGCATTATCACCAAGGATATTAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC201627 representing NM_004501
Red=Cloning site Green=Tags(s)

MSSSPVNVKKLKVSELKEELKKRRLSDKGLKAELMERLQAALDDEEAGGRPAMEPGNGSLDLGGDSAGRS
GAGLEQEAAAGGDEEEEEEEEEEEGISALDGDQMELGEENGAAGAADSGPMEEEEAASEDENGDDQGFQE
GEDELGDEEEGAGDENGHGEQQPQPPATQQQQPQQQRGAAKEAAGKSSGPTSLFAVTVAPPGARQGQQQA
GGDGKTEQKGGDKKRGVKRPREDHGRGYFEYIEENKYSRAKSPQPPVEEEDEHFDDTVVCLDTYNCDLHF
KISRDRLSASSLTMESFAFLWAGGRASYGVSKGKVCFEMKVTEKIPVRHLYTKDIDIHEVRIGWSLTTSG
MLLGEEEFSYGYSLKGIKTCNCETEDYGEKFDENDVITCFANFESDEVELSYAKNGQDLGVAFKISKEVL
AGRPLFPHVLCHNCAVEFNFGQKEKPYFPIPEEYTFIQNVPLEDRVRGPKGPEEKKDCEVVMMIGLPGAG
KTTWVTKHAAENPGKYNILGTNTIMDKMMVAGFKKQMADTGKLNTLLQRAPQCLGKFIEIAARKKRNFIL
DQTNVSAAAQRRKMCLFAGFQRKAVVVCPKDEDYKQRTQKKAEVEGKDLPEHAVLKMKGNFTLPEVAECF
DEITYVELQKEEAQKLLEQYKEESKKALPPEKKQNTGSKKSNKNKSGKNQFNRGGGHRGRGGFNMRGGNF
RGGAPGNRGGYNRRGNMPQRGGGGGGSGGIGYPYPRAPVFPGRGSYSNRGNYNRGGMPNRGNYNQNFRGR
GNNRGYKNQSQGYNQWQQGQFWGQKPWSQHYHQGYY

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_004501
ORF Size 2418 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_004501.1, NM_004501.2, NM_004501.3, NP_004492
RefSeq Size 6789
RefSeq ORF 2421
Locus ID 3192
Cytogenetics 1q44
Domains SAP, SPRY
Protein Families Druggable Genome
Protein Pathways Spliceosome
MW 88.8 kDa
Gene Summary This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they form complexes with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene contains a RNA binding domain and scaffold-associated region (SAR)-specific bipartite DNA-binding domain. This protein is also thought to be involved in the packaging of hnRNA into large ribonucleoprotein complexes. During apoptosis, this protein is cleaved in a caspase-dependent way. Cleavage occurs at the SALD site, resulting in a loss of DNA-binding activity and a concomitant detachment of this protein from nuclear structural sites. But this cleavage does not affect the function of the encoded protein in RNA metabolism. At least two alternatively spliced transcript variants have been identified for this gene. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)