CCDC22 (NM_014008) Human Tagged ORF Clone

CAT#: RC201585

CCDC22 (Myc-DDK-tagged)-Human coiled-coil domain containing 22 (CCDC22)

Need custom modification / cloning service?
Get a free quote

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Cited in 2 publications.

Product images

Specifications

Product Data
Product Name CCDC22 (NM_014008) Human Tagged ORF Clone
Symbol CCDC22
Synonyms CXorf37; JM1; RTSC2
Vector pCMV6-Entry
Sequence Data
>RC201585 representing NM_014008
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGGAGGCGGACCGAATCCTCATCCATTCGCTGCGCCAGGCCGGCACGGCAGTTCCTCCAGATGTGC
AGACCTTGCGCGCCTTCACCACTGAGCTGGTTGTAGAGGCTGTGGTCCGCTGCCTGCGTGTGATCAACCC
TGCGGTGGGCTCTGGCCTCAGCCCTCTGCTGCCTCTTGCCATGTCTGCCCGGTTCCGCCTGGCCATGAGC
CTGGCTCAGGCCTGCATGGACCTGGGCTATCCCTTGGAGCTTGGCTATCAGAACTTCCTCTACCCCAGTG
AGCCTGACCTCCGAGACCTGCTTCTCTTCTTGGCTGAGCGTCTGCCCACCGATGCCTCTGAGGATGCAGA
CCAGCCTGCAGGTGACTCAGCTATTCTCCTCCGGGCCATTGGGAGCCAAATTCGGGACCAGCTGGCACTG
CCTTGGGTCCCGCCCCACCTTCGCACTCCCAAGCTGCAGCACCTCCAGGGCTCGGCCCTCCAGAAGCCTT
TCCATGCCAGCAGGCTGGTCGTGCCAGAATTGAGTTCCAGAGGTGAGCCACGGGAGTTCCAGGCGAGTCC
CCTGCTGCTTCCAGTCCCTACCCAGGTGCCTCAGCCTGTTGGAAGGGTGGCCTCGCTCCTCGAACACCAT
GCCCTGCAGCTCTGCCAGCAGACGGGCCGGGACCGGCCAGGGGATGAGGACTGGGTCCACCGGACATCCC
GCCTCCCACCCCAGGAGGACACACGGGCTCAGCGGCAGCGGCTGCAGAAGCAACTGACTGAGCATCTGCG
CCAAAGCTGGGGCCTGCTTGGGGCCCCCATACAAGCCCGGGACCTGGGAGAACTGCTGCAGGCCTGGGGT
GCTGGGGCCAAGACTGGTGCTCCTAAGGGCTCCCGCTTCACGCACTCAGAGAAGTTCACCTTCCATCTGG
AGCCCCAGGCCCAGGCCACTCAGGTGTCAGATGTGCCAGCCACCTCCCGGCGGCCTGAACAGGTCACGTG
GGCAGCTCAGGAACAGGAGCTCGAGTCCCTTCGGGAGCAGCTGGAAGGAGTGAACCGCAGCATTGAGGAG
GTTGAGGCCGACATGAAGACCCTGGGCGTCAGCTTTGTGCAGGCAGAGTCTGAGTGCCGGCACAGCAAGC
TCAGTACAGCAGAGCGTGAGCAGGCCCTGCGCCTGAAGAGCCGCGCGGTGGAGCTGCTGCCCGATGGGAC
TGCCAACCTTGCCAAGCTGCAGCTTGTGGTGGAGAATAGTGCCCAGCGGGTCATCCACTTGGCGGGTCAG
TGGGAGAAGCACCGGGTCCCACTCCTCGCTGAGTACCGCCACCTCCGAAAGCTGCAGGATTGCAGAGAGC
TGGAATCTTCTCGACGGCTGGCAGAGATCCAAGAACTGCACCAGAGTGTCCGGGCGGCTGCTGAAGAGGC
CCGCAGGAAGGAGGAGGTCTATAAGCAGCTGATGTCAGAGCTGGAGACTCTGCCCAGAGATGTGTCCCGG
CTGGCCTACACCCAGCGCATCCTGGAGATCGTGGGCAACATCCGGAAGCAGAAGGAAGAGATCACCAAGA
TCTTGTCTGATACGAAGGAGCTTCAGAAGGAAATCAACTCCCTATCTGGGAAGCTGGACCGGACGTTTGC
GGTGACTGATGAGCTTGTGTTCAAGGATGCCAAGAAGGACGATGCTGTTCGGAAGGCCTATAAGTATCTA
GCTGCTCTGCACGAGAACTGCAGCCAGCTCATCCAGACCATCGAGGACACAGGCACCATCATGCGGGAGG
TTCGAGACCTCGAGGAGCAGATCGAGACAGAGCTGGGCAAGAAGACCCTCAGCAACCTGGAGAAGATCCG
GGAGGACTACCGAGCCCTCCGCCAGGAGAACGCTGGCCTCCTAGGCCGGGTCCGGGAGGCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC201585 representing NM_014008
Red=Cloning site Green=Tags(s)

MEEADRILIHSLRQAGTAVPPDVQTLRAFTTELVVEAVVRCLRVINPAVGSGLSPLLPLAMSARFRLAMS
LAQACMDLGYPLELGYQNFLYPSEPDLRDLLLFLAERLPTDASEDADQPAGDSAILLRAIGSQIRDQLAL
PWVPPHLRTPKLQHLQGSALQKPFHASRLVVPELSSRGEPREFQASPLLLPVPTQVPQPVGRVASLLEHH
ALQLCQQTGRDRPGDEDWVHRTSRLPPQEDTRAQRQRLQKQLTEHLRQSWGLLGAPIQARDLGELLQAWG
AGAKTGAPKGSRFTHSEKFTFHLEPQAQATQVSDVPATSRRPEQVTWAAQEQELESLREQLEGVNRSIEE
VEADMKTLGVSFVQAESECRHSKLSTAEREQALRLKSRAVELLPDGTANLAKLQLVVENSAQRVIHLAGQ
WEKHRVPLLAEYRHLRKLQDCRELESSRRLAEIQELHQSVRAAAEEARRKEEVYKQLMSELETLPRDVSR
LAYTQRILEIVGNIRKQKEEITKILSDTKELQKEINSLSGKLDRTFAVTDELVFKDAKKDDAVRKAYKYL
AALHENCSQLIQTIEDTGTIMREVRDLEEQIETELGKKTLSNLEKIREDYRALRQENAGLLGRVREA

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_014008
ORF Size 1881 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_014008.1, NM_014008.2, NM_014008.3, NM_014008.4, NP_054727
RefSeq Size 2715
RefSeq ORF 1884
Locus ID 28952
Cytogenetics Xp11.23
MW 70.6 kDa
Gene Summary This gene encodes a protein containing a coiled-coil domain. The encoded protein functions in the regulation of NF-kB (nuclear factor kappa-light-chain-enhancer of activated B cells) by interacting with COMMD (copper metabolism Murr1 domain-containing) proteins. The mouse orthologous protein has been shown to bind copines, which are calcium-dependent, membrane-binding proteins that may function in calcium signaling. This human gene has been identified as a novel candidate gene for syndromic X-linked intellectual disability. [provided by RefSeq, Aug 2013].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (2)