IRF6 (NM_006147) Human Tagged ORF Clone

CAT#: RC201579

Reviews ()
Write a review

IRF6 (Myc-DDK-tagged)-Human interferon regulatory factor 6 (IRF6), transcript variant 1



  "NM_006147" in other vectors (7)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 477.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol IRF6
Synonyms LPS; OFC6; PIT; PPS; PPS1; VWS; VWS1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC201579 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCCTCCACCCCCGCAGAGTCCGGCTAAAGCCCTGGCTGGTGGCCCAGGTGGATAGTGGCCTCTACC
CTGGGCTCATCTGGCTACACAGGGACTCTAAACGCTTCCAGATTCCCTGGAAACATGCCACCCGGCATAG
CCCTCAACAAGAAGAGGAAAATACCATTTTTAAGGCCTGGGCTGTAGAGACAGGGAAGTACCAGGAAGGG
GTGGATGACCCTGACCCAGCTAAATGGAAGGCCCAGCTGCGCTGTGCTCTCAATAAGAGCAGAGAATTCA
ACCTGATGTATGATGGCACCAAGGAGGTGCCCATGAACCCAGTGAAGATATATCAAGTGTGTGACATCCC
TCAGCCCCAGGGCTCGATCATTAACCCAGGATCCACAGGGTCTGCTCCCTGGGATGAGAAGGATAATGAT
GTGGATGAAGAAGATGAGGAAGATGAGCTGGATCAGTCGCAGCACCATGTTCCCATCCAGGACACCTTCC
CCTTCCTGAACATCAATGGTTCTCCCATGGCGCCAGCCAGTGTGGGCAATTGCAGTGTGGGCAACTGCAG
CCCGGAGGCAGTGTGGCCCAAAACTGAACCCCTGGAGATGGAAGTACCCCAGGCACCTATACAGCCCTTC
TATAGCTCTCCAGAACTGTGGATCAGCTCTCTCCCAATGACTGACCTGGACATCAAGTTTCAGTACCGTG
GGAAGGAGTACGGGCAGACCATGACCGTGAGCAACCCTCAGGGCTGCCGACTCTTCTATGGGGACCTGGG
TCCCATGCCTGACCAGGAGGAGCTCTTTGGTCCCGTCAGCCTGGAGCAGGTCAAATTCCCAGGTCCTGAG
CATATTACCAATGAGAAGCAGAAGCTGTTCACTAGCAAGCTGCTGGACGTCATGGACAGAGGACTGATCC
TGGAGGTCAGCGGTCATGCCATTTATGCCATCAGGCTGTGCCAGTGCAAGGTGTACTGGTCTGGGCCATG
TGCCCCATCACTTGTTGCTCCCAACCTGATTGAGAGACAAAAGAAGGTCAAGCTATTTTGTCTGGAAACA
TTCCTTAGCGATCTCATTGCCCACCAGAAAGGACAGATAGAGAAGCAGCCACCGTTTGAGATCTACTTAT
GCTTTGGGGAAGAATGGCCAGATGGGAAACCATTGGAAAGGAAACTCATCTTGGTTCAGGTCATTCCAGT
AGTGGCTCGGATGATCTACGAGATGTTTTCTGGTGATTTCACACGATCCTTTGATAGTGGCAGTGTCCGC
CTGCAGATCTCAACCCCAGACATCAAGGATAACATCGTTGCTCAGCTGAAGCAGCTGTACCGCATCCTTC
AAACCCAGGAGAGCTGGCAGCCCATGCAGCCCACCCCCAGCATGCAACTGCCCCCTGCCCTGCCTCCCCA
G


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC201579 protein sequence
Red=Cloning site Green=Tags(s)

MALHPRRVRLKPWLVAQVDSGLYPGLIWLHRDSKRFQIPWKHATRHSPQQEEENTIFKAWAVETGKYQEG
VDDPDPAKWKAQLRCALNKSREFNLMYDGTKEVPMNPVKIYQVCDIPQPQGSIINPGSTGSAPWDEKDND
VDEEDEEDELDQSQHHVPIQDTFPFLNINGSPMAPASVGNCSVGNCSPEAVWPKTEPLEMEVPQAPIQPF
YSSPELWISSLPMTDLDIKFQYRGKEYGQTMTVSNPQGCRLFYGDLGPMPDQEELFGPVSLEQVKFPGPE
HITNEKQKLFTSKLLDVMDRGLILEVSGHAIYAIRLCQCKVYWSGPCAPSLVAPNLIERQKKVKLFCLET
FLSDLIAHQKGQIEKQPPFEIYLCFGEEWPDGKPLERKLILVQVIPVVARMIYEMFSGDFTRSFDSGSVR
LQISTPDIKDNIVAQLKQLYRILQTQESWQPMQPTPSMQLPPALPPQ

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_006147
ORF Size 1401 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_006147.4
RefSeq Size 4505 bp
RefSeq ORF 1404 bp
Locus ID 3664
UniProt ID O14896
Cytogenetics 1q32.2
Domains IRF
Protein Families ES Cell Differentiation/IPS, Transcription Factors
MW 53.1 kDa
Gene Summary This gene encodes a member of the interferon regulatory transcription factor (IRF) family. Family members share a highly-conserved N-terminal helix-turn-helix DNA-binding domain and a less conserved C-terminal protein-binding domain. The encoded protein may be a transcriptional activator. Mutations in this gene can cause van der Woude syndrome and popliteal pterygium syndrome. Mutations in this gene are also associated with non-syndromic orofacial cleft type 6. Alternate splicing results in multiple transcript variants.[provided by RefSeq, May 2011]

Other Versions

Other products for "IRF6"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


IRF6 mouse monoclonal antibody, clone OTI2C10 (formerly 2C10)
    • 100 ul

USD 417.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.