KDELR3 (NM_006855) Human Tagged ORF Clone

CAT#: RC201571

Reviews ()
Write a review

KDELR3 (Myc-DDK-tagged)-Human KDEL (Lys-Asp-Glu-Leu) endoplasmic reticulum protein retention receptor 3 (KDELR3), transcript variant 1


 Cited in 1 publication.

  "NM_006855" in other vectors (6)

USD 98.00

USD 390.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name KDELR3 (NM_006855) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol KDELR3
Synonyms ERD2L3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC201571 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAACGTGTTCCGAATCCTCGGCGACCTGAGCCACCTCCTGGCCATGATCTTGCTGCTGGGGAAGATCT
GGAGGTCCAAGTGCTGCAAGGGCATCTCTGGGAAGAGCCAGATCCTGTTTGCTCTCGTCTTCACCACCAG
GTACCTGGACCTGTTCACCAACTTCATCTCCATCTACAACACAGTAATGAAGGTGGTTTTTCTCCTCTGT
GCCTATGTTACAGTGTACATGATATATGGGAAATTCCGTAAAACTTTTGACAGTGAGAATGACACATTCC
GCCTGGAGTTTCTTCTGGTCCCAGTCATTGGCCTTTCCTTCCTTGAAAACTACAGTTTCACTCTGCTGGA
GATCCTCTGGACTTTCTCTATCTATCTGGAATCAGTGGCTATCCTGCCCCAGCTCTTCATGATCAGCAAG
ACTGGAGAGGCTGAGACCATAACTACTCACTACCTGTTCTTTCTGGGTCTGTACCGGGCACTCTACCTGG
CTAACTGGATCAGGCGGTACCAGACTGAGAATTTCTATGACCAAATTGCAGTCGTGTCTGGAGTAGTACA
AACCATCTTCTACTGTGACTTCTTCTACTTGTATGTGACCAAAGTCCTTAAGGGAAAGAAGTTAAGTCTT
CCAATGCCAATC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC201571 protein sequence
Red=Cloning site Green=Tags(s)

MNVFRILGDLSHLLAMILLLGKIWRSKCCKGISGKSQILFALVFTTRYLDLFTNFISIYNTVMKVVFLLC
AYVTVYMIYGKFRKTFDSENDTFRLEFLLVPVIGLSFLENYSFTLLEILWTFSIYLESVAILPQLFMISK
TGEAETITTHYLFFLGLYRALYLANWIRRYQTENFYDQIAVVSGVVQTIFYCDFFYLYVTKVLKGKKLSL
PMPI

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_006855
ORF Size 642 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_006855.1, NM_006855.2, NM_006855.3, NP_006846.1
RefSeq Size 1744
RefSeq ORF 645
Locus ID 11015
Cytogenetics 22q13.1
Protein Families Druggable Genome, Transmembrane
Protein Pathways Vibrio cholerae infection
MW 25 kDa
Gene Summary This gene encodes a member of the KDEL endoplasmic reticulum protein retention receptor family. Retention of resident soluble proteins in the lumen of the endoplasmic reticulum (ER) is achieved in both yeast and animal cells by their continual retrieval from the cis-Golgi, or a pre-Golgi compartment. Sorting of these proteins is dependent on a C-terminal tetrapeptide signal, usually lys-asp-glu-leu (KDEL) in animal cells, and his-asp-glu-leu (HDEL) in S. cerevisiae. This process is mediated by a receptor that recognizes, and binds the tetrapeptide-containing protein, and returns it to the ER. In yeast, the sorting receptor encoded by a single gene, ERD2, is a seven-transmembrane protein. Unlike yeast, several human homologs of the ERD2 gene, constituting the KDEL receptor gene family, have been described. KDELR3 was the third member of the family to be identified. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]

Citations (1)

Other Versions

Other products for "KDELR3"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


Rabbit Polyclonal Anti-KDELR3 Antibody
    • 100 ul

USD 375.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools