N myc interactor (NMI) (NM_004688) Human Tagged ORF Clone

CAT#: RC201543

Reviews ()
Write a review

NMI (Myc-DDK-tagged)-Human N-myc (and STAT) interactor (NMI)



Reconstitution Protocol

USD 300.00

In Stock*

Size
    • 10 ug

Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol NMI
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC201543 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAAGCTGATAAAGATGACACACAACAAATTCTTAAGGAGCATTCGCCAGATGAATTTATAAAAGATG
AACAAAATAAGGGACTAATTGATGAAATTACAAAGAAAAATATTCAACTAAAGAAGGAGATCCAAAAGCT
TGAAACGGAGTTACAAGAGGCTACCAAAGAATTCCAGATTAAAGAGGATATTCCTGAAACAAAGATGAAA
TTCTTATCAGTTGAAACTCCTGAGAATGACAGCCAGTTGTCAAATATCTCCTGTTCATTTCAAGTGAGCT
CGAAAGTTCCTTATGAGATACAAAAAGGACAAGCACTTATCACCTTTGAAAAAGAAGAAGTTGCTCAAAA
TGTGGTAAGCATGAGTAAACATCATGTACAGATAAAAGATGTAAATCTGGAGGTTACGGCCAAGCCAGTT
CCATTAAATTCAGGAGTCAGATTCCAGGTTTATGTAGAAGTTTCTAAAATGAAAATCAATGTTACTGAAA
TTCCTGACACATTGCGTGAAGATCAAATGAGAGACAAACTAGAGCTGAGCTTTTCAAAGTCCCGAAATGG
AGGCGGAGAGGTGGACCGCGTGGACTATGACAGACAGTCCGGGAGTGCAGTCATCACGTTTGTGGAGATT
GGAGTGGCTGACAAGATTTTGAAAAAGAAAGAATACCCTCTTTATATAAATCAAACCTGCCATAGAGTTA
CTGTTTCTCCATACACAGAAATACACTTGAAAAAGTATCAGATATTTTCAGGAACATCTAAGAGGACAGT
GCTTCTGACAGGAATGGAAGGCATTCAAATGGATGAAGAAATTGTGGAGGATTTAATTAACATTCACTTT
CAACGGGCAAAGAATGGAGGTGGAGAAGTAGATGTGGTCAAGTGTTCTCTAGGTCAACCTCACATAGCAT
ACTTTGAAGAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC201543 protein sequence
Red=Cloning site Green=Tags(s)

MEADKDDTQQILKEHSPDEFIKDEQNKGLIDEITKKNIQLKKEIQKLETELQEATKEFQIKEDIPETKMK
FLSVETPENDSQLSNISCSFQVSSKVPYEIQKGQALITFEKEEVAQNVVSMSKHHVQIKDVNLEVTAKPV
PLNSGVRFQVYVEVSKMKINVTEIPDTLREDQMRDKLELSFSKSRNGGGEVDRVDYDRQSGSAVITFVEI
GVADKILKKKEYPLYINQTCHRVTVSPYTEIHLKKYQIFSGTSKRTVLLTGMEGIQMDEEIVEDLINIHF
QRAKNGGGEVDVVKCSLGQPHIAYFEE

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_004688
ORF Size 921 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_004688.3
RefSeq Size 1501 bp
RefSeq ORF 924 bp
Locus ID 9111
UniProt ID Q13287
Cytogenetics 2q23.3
Protein Families Druggable Genome, Transcription Factors
MW 35.1 kDa
Gene Summary NMYC interactor (NMI) encodes a protein that interacts with NMYC and CMYC (two members of the oncogene Myc family), and other transcription factors containing a Zip, HLH, or HLH-Zip motif. The NMI protein also interacts with all STATs except STAT2 and augments STAT-mediated transcription in response to cytokines IL2 and IFN-gamma. The NMI mRNA has low expression levels in all human fetal and adult tissues tested except brain and has high expression in cancer cell line-myeloid leukemias. [provided by RefSeq, Jul 2008]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.