PPIH (NM_006347) Human Tagged ORF Clone

CAT#: RC201529

PPIH (Myc-DDK-tagged)-Human peptidylprolyl isomerase H (cyclophilin H) (PPIH)



  "NM_006347" in other vectors (6)

Reconstitution Protocol

USD 300.00

USD 450.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (4)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "PPIH"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol PPIH
Synonyms CYP-20; CYPH; SnuCyp-20; USA-CYP
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC201529 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGTGGCAAATTCAAGTCCTGTTAACCCCGTGGTGTTCTTTGATGTCAGTATTGGCGGTCAGGAAG
TTGGCCGCATGAAGATCGAGCTCTTTGCAGACGTTGTGCCTAAGACGGCCGAGAACTTTAGGCAGTTCTG
CACCGGAGAATTCAGGAAAGATGGGGTTCCAATAGGATACAAAGGAAGCACCTTCCACAGGGTCATAAAG
GATTTCATGATTCAGGGTGGAGATTTTGTTAATGGAGATGGTACTGGAGTCGCCAGTATTTACCGGGGGC
CATTTGCAGATGAAAATTTTAAACTTAGACACTCAGCTCCAGGCCTGCTTTCCATGGCGAACAGTGGTCC
AAGTACAAATGGCTGTCAGTTCTTTATCACCTGCTCTAAGTGCGATTGGCTGGATGGGAAGCATGTGGTG
TTTGGAAAAATCATCGATGGACTTCTAGTGATGAGAAAGATTGAGAATGTTCCCACAGGCCCCAACAATA
AGCCCAAGCTACCTGTGGTGATCTCGCAGTGTGGGGAGATG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC201529 protein sequence
Red=Cloning site Green=Tags(s)

MAVANSSPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVIK
DFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVV
FGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_006347
ORF Size 531 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_006347.4
RefSeq Size 813 bp
RefSeq ORF 534 bp
Locus ID 10465
UniProt ID O43447
Cytogenetics 1p34.2
Domains pro_isomerase
Protein Pathways Spliceosome
MW 19.2 kDa
Gene Summary The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein is a specific component of the complex that includes pre-mRNA processing factors PRPF3, PRPF4, and PRPF18, as well as U4/U5/U6 tri-snRNP. This protein has been shown to possess PPIase activity and may act as a protein chaperone that mediates the interactions between different proteins inside the spliceosome. [provided by RefSeq, Jul 2008]

Other Versions

{0} Product Review(s)

0 Product Review(s)

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.