PPIH (NM_006347) Human Tagged ORF Clone

USD 98.00

USD 390.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name PPIH (NM_006347) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol PPIH
Synonyms CYP-20; CYPH; SnuCyp-20; USA-CYP
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC201529 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGTGGCAAATTCAAGTCCTGTTAACCCCGTGGTGTTCTTTGATGTCAGTATTGGCGGTCAGGAAG
TTGGCCGCATGAAGATCGAGCTCTTTGCAGACGTTGTGCCTAAGACGGCCGAGAACTTTAGGCAGTTCTG
CACCGGAGAATTCAGGAAAGATGGGGTTCCAATAGGATACAAAGGAAGCACCTTCCACAGGGTCATAAAG
GATTTCATGATTCAGGGTGGAGATTTTGTTAATGGAGATGGTACTGGAGTCGCCAGTATTTACCGGGGGC
CATTTGCAGATGAAAATTTTAAACTTAGACACTCAGCTCCAGGCCTGCTTTCCATGGCGAACAGTGGTCC
AAGTACAAATGGCTGTCAGTTCTTTATCACCTGCTCTAAGTGCGATTGGCTGGATGGGAAGCATGTGGTG
TTTGGAAAAATCATCGATGGACTTCTAGTGATGAGAAAGATTGAGAATGTTCCCACAGGCCCCAACAATA
AGCCCAAGCTACCTGTGGTGATCTCGCAGTGTGGGGAGATG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC201529 protein sequence
Red=Cloning site Green=Tags(s)

MAVANSSPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVIK
DFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVV
FGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_006347
ORF Size 531 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_006347.1, NM_006347.2, NM_006347.3, NP_006338.1
RefSeq Size 813 bp
RefSeq ORF 534 bp
Locus ID 10465
Cytogenetics 1p34.2
Domains pro_isomerase
Protein Pathways Spliceosome
MW 19.2 kDa
Gene Summary The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein is a specific component of the complex that includes pre-mRNA processing factors PRPF3, PRPF4, and PRPF18, as well as U4/U5/U6 tri-snRNP. This protein has been shown to possess PPIase activity and may act as a protein chaperone that mediates the interactions between different proteins inside the spliceosome. [provided by RefSeq, Jul 2008]

Citations (1)

Other Versions

Other products for "PPIH"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


PPIH mouse monoclonal antibody, clone OTI1C6 (formerly 1C6)
    • 100 ul

USD 379.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools