PPIH (NM_006347) Human Tagged ORF Clone

CAT#: RC201529

PPIH (Myc-DDK-tagged)-Human peptidylprolyl isomerase H (cyclophilin H) (PPIH)

Product Images

HEK293T cells were transfected with the pCMV6-ENTRY control (Cat# PS100001, Left lane) or pCMV6-ENTRY PPIH (Cat# RC201529, Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-PPIH(Cat# TA803474). Positive lysates LY416702 (100ug) and LC416702 (20ug) can be purchased separately from OriGene.

• 

  Western blot validation of overexpression lysate (Cat# LY416702) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC201529 using transfection reagent MegaTran 2.0 (Cat# TT210002).

• 

  Coomassie blue staining of purified PPIH protein (Cat# TP301529). The protein was produced from HEK293T cells transfected with PPIH cDNA clone (Cat# RC201529) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: PPIH
• Synonyms: CYP-20; CYPH; SnuCyp-20; USA-CYP
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC201529 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGCGGTGGCAAATTCAAGTCCTGTTAACCCCGTGGTGTTCTTTGATGTCAGTATTGGCGGTCAGGAAG
  TTGGCCGCATGAAGATCGAGCTCTTTGCAGACGTTGTGCCTAAGACGGCCGAGAACTTTAGGCAGTTCTG
  CACCGGAGAATTCAGGAAAGATGGGGTTCCAATAGGATACAAAGGAAGCACCTTCCACAGGGTCATAAAG
  GATTTCATGATTCAGGGTGGAGATTTTGTTAATGGAGATGGTACTGGAGTCGCCAGTATTTACCGGGGGC
  CATTTGCAGATGAAAATTTTAAACTTAGACACTCAGCTCCAGGCCTGCTTTCCATGGCGAACAGTGGTCC
  AAGTACAAATGGCTGTCAGTTCTTTATCACCTGCTCTAAGTGCGATTGGCTGGATGGGAAGCATGTGGTG
  TTTGGAAAAATCATCGATGGACTTCTAGTGATGAGAAAGATTGAGAATGTTCCCACAGGCCCCAACAATA
  AGCCCAAGCTACCTGTGGTGATCTCGCAGTGTGGGGAGATG
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC201529 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAVANSSPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVIK
  DFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVV
  FGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_006347
• ORF Size: 531 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_006347.4
• RefSeq Size: 813 bp
• RefSeq ORF: 534 bp
• Locus ID: 10465
• UniProt ID: O43447
• Cytogenetics: 1p34.2
• Domains: pro_isomerase
• Protein Pathways: Spliceosome
• MW: 19.2 kDa
• Gene Summary: The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein is a specific component of the complex that includes pre-mRNA processing factors PRPF3, PRPF4, and PRPF18, as well as U4/U5/U6 tri-snRNP. This protein has been shown to possess PPIase activity and may act as a protein chaperone that mediates the interactions between different proteins inside the spliceosome. [provided by RefSeq, Jul 2008]