GPCR150(GPR160) (NM_014373) Human Tagged ORF Clone

CAT#: RC201523

GPR160 (Myc-DDK-tagged)-Human G protein-coupled receptor 160 (GPR160)

Change vector?

  • TrueORF®

USD 577


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name GPCR150(GPR160) (NM_014373) Human Tagged ORF Clone
Symbol GPR160
Synonyms GPCR1; GPCR150
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC201523 representing NM_014373
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACTGCTCTCTCTTCAGAGAACTGCTCTTTTCAGTACCAGTTACGTCAAACAAACCAGCCCCTAGATG
TTAACTATCTGCTATTCTTGATCATACTTGGGAAAATATTATTAAATATCCTTACACTAGGAATGAGAAG
AAAAAACACCTGTCAAAATTTTATGGAATATTTTTGCATTTCACTAGCATTCGTTGATCTTTTACTTTTG
GTAAACATTTCCATTATATTGTATTTCAGGGATTTTGTACTTTTAAGCATTAGGTTCACTAAATACCACA
TCTGCCTATTTACTCAAATTATTTCCTTTACTTATGGCTTTTTGCATTATCCAGTTTTCCTGACAGCTTG
TATAGATTATTGCCTGAATTTCTCTAAAACAACCAAGCTTTCATTTAAGTGTCAAAAATTATTTTATTTC
TTTACAGTAATTTTAATTTGGATTTCAGTCCTTGCTTATGTTTTGGGAGACCCAGCCATCTACCAAAGCC
TGAAGGCACAGAATGCTTATTCTCGTCACTGTCCTTTCTATGTCAGCATTCAGAGTTACTGGCTGTCATT
TTTCATGGTGATGATTTTATTTGTAGCTTTCATAACCTGTTGGGAAGAAGTTACTACTTTGGTACAGGCT
ATCAGGATAACTTCCTATATGAATGAAACTATCTTATATTTTCCTTTTTCATCCCACTCCAGTTATACTG
TGAGATCTAAAAAAATATTCTTATCCAAGCTCATTGTCTGTTTTCTCAGTACCTGGTTACCATTTGTACT
ACTTCAGGTAATCATTGTTTTACTTAAAGTTCAGATTCCAGCATATATTGAGATGAATATTCCCTGGTTA
TACTTTGTCAATAGTTTTCTCATTGCTACAGTGTATTGGTTTAATTGTCACAAGCTTAATTTAAAAGACA
TTGGATTACCTTTGGATCCATTTGTCAACTGGAAGTGCTGCTTCATTCCACTTACAATTCCTAATCTTGA
GCAAATTGAAAAGCCTATATCAATAATGATTTGT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC201523 representing NM_014373
Red=Cloning site Green=Tags(s)

MTALSSENCSFQYQLRQTNQPLDVNYLLFLIILGKILLNILTLGMRRKNTCQNFMEYFCISLAFVDLLLL
VNISIILYFRDFVLLSIRFTKYHICLFTQIISFTYGFLHYPVFLTACIDYCLNFSKTTKLSFKCQKLFYF
FTVILIWISVLAYVLGDPAIYQSLKAQNAYSRHCPFYVSIQSYWLSFFMVMILFVAFITCWEEVTTLVQA
IRITSYMNETILYFPFSSHSSYTVRSKKIFLSKLIVCFLSTWLPFVLLQVIIVLLKVQIPAYIEMNIPWL
YFVNSFLIATVYWFNCHKLNLKDIGLPLDPFVNWKCCFIPLTIPNLEQIEKPISIMIC

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_014373
ORF Size 1014 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_014373.1, NM_014373.2, NP_055188
RefSeq Size 1749
RefSeq ORF 1017
Locus ID 26996
Cytogenetics 3q26.2
Protein Families GPCR, Transmembrane, Druggable Genome
MW 39.6 kDa
Gene Summary Orphan receptor. [UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.