HOXC11 (NM_014212) Human Tagged ORF Clone

CAT#: RC201475

HOXC11 (Myc-DDK-tagged)-Human homeobox C11 (HOXC11)

Product Images

Circular map for RC201475

• 

  HEK293T cells were transfected with the pCMV6-ENTRY control (Cat# PS100001, Left lane) or pCMV6-ENTRY HOXC11 (Cat# RC201475, Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-HOXC11(Cat# TA502572). Positive lysates LY415427 (100ug) and LC415427 (20ug) can be purchased separately from OriGene.

• 

  Western blot validation of overexpression lysate (Cat# LY415427) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC201475 using transfection reagent MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: HOXC11
• Synonyms: HOX3H
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC201475 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGTTTAACTCGGTCAACCTGGGCAACTTCTGCTCGCCGTCGCGCAAGGAGAGGGGCGCAGATTTCGGCG
  AGCGAGGGAGCTGCGCCTCCAACCTCTATCTGCCCAGTTGCACTTACTACATGCCCGAGTTCTCCACGGT
  CTTCTCCTTCCTGCCCCAGGCCCCCTCTCGTCAGATCTCCTATCCCTACTCGGCCCAAGTGCCCCCGGTC
  CGGGAGGTCTCCTACGGCCTGGAGCCATCCGGCAAGTGGCACCATCGGAACAGCTACTCCTCCTGCTATG
  CGGCGGCCGACGAGCTTATGCACCGGGAGTGCCTGCCTCCTTCCACCGTCACCGAGATCCTCATGAAAAA
  CGAAGGCTCCTACGGCGGCCACCACCACCCCAGCGCCCCGCACGCAACCCCCGCCGGCTTCTACTCCTCA
  GTCAACAAGAACAGCGTCCTGCCTCAAGCCTTCGACCGTTTCTTCGACAACGCCTACTGCGGTGGCGGCG
  ACCCGCCCGCCGAGCCCCCCTGCTCCGGCAAGGGCGAGGCCAAGGGGGAGCCCGAGGCACCCCCGGCCTC
  GGGACTGGCGTCCCGGGCTGAGGCGGGTGCCGAGGCGGAGGCTGAGGAGGAGAACACAAATCCCAGCTCG
  TCCGGTTCAGCCCACTCCGTGGCCAAGGAGCCGGCCAAAGGAGCCGCCCCCAACGCCCCCCGCACCCGCA
  AGAAGCGCTGCCCTTATTCGAAATTCCAGATCCGGGAACTGGAGCGAGAGTTTTTCTTCAACGTGTATAT
  CAACAAAGAGAAGCGGCTGCAGCTGTCCCGGATGCTGAACCTGACGGACCGACAAGTGAAAATTTGGTTT
  CAGAACAGAAGGATGAAAGAAAAGAAACTGAGCAGAGACCGGCTGCAGTATTTCTCGGGAAATCCTCTGC
  TG
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC201475 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MFNSVNLGNFCSPSRKERGADFGERGSCASNLYLPSCTYYMPEFSTVFSFLPQAPSRQISYPYSAQVPPV
  REVSYGLEPSGKWHHRNSYSSCYAAADELMHRECLPPSTVTEILMKNEGSYGGHHHPSAPHATPAGFYSS
  VNKNSVLPQAFDRFFDNAYCGGGDPPAEPPCSGKGEAKGEPEAPPASGLASRAEAGAEAEAEEENTNPSS
  SGSAHSVAKEPAKGAAPNAPRTRKKRCPYSKFQIRELEREFFFNVYINKEKRLQLSRMLNLTDRQVKIWF
  QNRRMKEKKLSRDRLQYFSGNPLL
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_014212
• ORF Size: 912 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_014212.4
• RefSeq Size: 2100 bp
• RefSeq ORF: 915 bp
• Locus ID: 3227
• UniProt ID: O43248
• Cytogenetics: 12q13.13
• MW: 33.8 kDa
• Gene Summary: This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXC genes located in a cluster on chromosome 12. The product of this gene binds to a promoter element of the lactase-phlorizin hydrolase. It also may play a role in early intestinal development. An alternatively spliced variant encoding a shorter isoform has been described but its full-length nature has not been determined. [provided by RefSeq, Jul 2008]