Glutathione S Transferase kappa 1(GSTK1) (NM_015917) Human Tagged ORF Clone

CAT#: RC201467

GSTK1 (Myc-DDK-tagged)-Human glutathione S-transferase kappa 1 (GSTK1), nuclear gene encoding mitochondrial protein, transcript variant 1

Clone Modification / Custom Cloning Service

USD 98.00

USD 390.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Glutathione S Transferase kappa 1(GSTK1) (NM_015917) Human Tagged ORF Clone
Symbol GSTK1
Synonyms GST; GST 13-13; GST13; GST13-13; GSTK1-1; hGSTK1
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC201467 representing NM_015917
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGCCCCTGCCGCGCACCGTGGAGCTCTTCTATGACGTGCTGTCCCCCTACTCCTGGCTGGGCTTCG
AGATCCTGTGCCGGTATCAGAATATCTGGAACATCAACCTGCAGTTGCGGCCCAGCCTCATAACAGGGAT
CATGAAAGACAGTGGAAACAAGCCTCCAGGTCTGCTTCCCCGCAAAGGACTATACATGGCAAATGACTTA
AAGCTCCTGAGACACCATCTCCAGATTCCCATCCACTTCCCCAAGGATTTCTTGTCTGTGATGCTTGAAA
AAGGAAGTTTGTCTGCCATGCGTTTCCTCACCGCCGTGAACTTGGAGCATCCAGAGATGCTGGAGAAAGC
GTCCCGGGAGCTGTGGATGCGCGTCTGGTCAAGGAATGAAGACATCACCGAGCCGCAGAGCATCCTGGCG
GCTGCAGAGAAGGCTGGTATGTCTGCAGAACAAGCCCAGGGACTTCTGGAAAAGATCGCAACGCCAAAGG
TGAAGAACCAGCTCAAGGAGACCACTGAGGCAGCCTGCAGATACGGAGCCTTTGGGCTGCCCATCACCGT
GGCCCATGTGGATGGCCAAACCCACATGTTATTTGGCTCTGACCGGATGGAGCTGCTGGCGCACCTGCTG
GGAGAGAAGTGGATGGGCCCTATACCTCCAGCCGTGAATGCCAGACTT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC201467 representing NM_015917
Red=Cloning site Green=Tags(s)

MGPLPRTVELFYDVLSPYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDL
KLLRHHLQIPIHFPKDFLSVMLEKGSLSAMRFLTAVNLEHPEMLEKASRELWMRVWSRNEDITEPQSILA
AAEKAGMSAEQAQGLLEKIATPKVKNQLKETTEAACRYGAFGLPITVAHVDGQTHMLFGSDRMELLAHLL
GEKWMGPIPPAVNARL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_015917
ORF Size 678 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_015917.1, NM_015917.2, NP_057001
RefSeq Size 1017
RefSeq ORF 681
Locus ID 373156
Cytogenetics 7q34
Domains DSBA
Protein Pathways Glutathione metabolism, Metabolism of xenobiotics by cytochrome P450, Drug metabolism - cytochrome P450
MW 25.3 kDa
Gene Summary This gene encodes a member of the kappa class of the glutathione transferase superfamily of enzymes that function in cellular detoxification. The encoded protein is localized to the peroxisome and catalyzes the conjugation of glutathione to a wide range of hydrophobic substates facilitating the removal of these compounds from cells. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Jan 2009].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations