ARD1A(NAA10) (NM_003491) Human Tagged ORF Clone

CAT#: RC201354

NAA10 (Myc-DDK-tagged)-Human N(alpha)-acetyltransferase 10, NatA catalytic subunit (NAA10)

Clone Modification / Custom Cloning Service

USD 98.00

USD 390.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name ARD1A(NAA10) (NM_003491) Human Tagged ORF Clone
Symbol NAA10
Synonyms ARD1; ARD1A; ARD1P; DXS707; MCOPS1; NATD; OGDNS; TE2
Vector pCMV6-Entry
Sequence Data
>RC201354 representing NM_003491
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAACATCCGCAATGCGAGGCCAGAGGACCTAATGAACATGCAGCACTGCAACCTCCTCTGCCTGCCCG
AGAACTACCAGATGAAATACTACTTCTACCATGGCCTTTCCTGGCCCCAGCTCTCTTACATTGCTGAGGA
CGAGAATGGGAAGATTGTGGGGTATGTCCTGGCCAAAATGGAAGAGGACCCAGATGATGTGCCCCATGGA
CATATCACCTCATTGGCTGTGAAGCGTTCCCACCGGCGCCTCGGTCTGGCTCAGAAACTGATGGACCAGG
CCTCTCGAGCCATGATAGAGAACTTCAATGCCAAATATGTCTCCCTGCATGTCAGGAAGAGTAACCGGGC
CGCCCTGCACCTCTATTCCAACACCCTCAACTTTCAGATCAGTGAAGTGGAGCCCAAATACTATGCAGAT
GGGGAGGACGCCTATGCCATGAAGCGGGACCTCACTCAGATGGCCGACGAGCTGAGGCGGCACCTGGAGC
TGAAAGAGAAGGGCAGGCACGTGGTGCTGGGTGCCATCGAGAACAAGGTGGAGAGCAAAGGCAATTCACC
TCCGAGCTCAGGAGAGGCCTGTCGCGAGGAGAAGGGCCTGGCTGCCGAGGATAGTGGTGGGGACAGCAAG
GACCTCAGCGAGGTCAGCGAGACCACAGAGAGCACAGATGTCAAGGACAGCTCAGAGGCCTCCGACTCAG
CCTCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC201354 representing NM_003491
Red=Cloning site Green=Tags(s)

MNIRNARPEDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDENGKIVGYVLAKMEEDPDDVPHG
HITSLAVKRSHRRLGLAQKLMDQASRAMIENFNAKYVSLHVRKSNRAALHLYSNTLNFQISEVEPKYYAD
GEDAYAMKRDLTQMADELRRHLELKEKGRHVVLGAIENKVESKGNSPPSSGEACREEKGLAAEDSGGDSK
DLSEVSETTESTDVKDSSEASDSAS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_003491
ORF Size 705 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_003491.1, NM_003491.2, NM_003491.3, NP_003482
RefSeq Size 916
RefSeq ORF 708
Locus ID 8260
Cytogenetics Xq28
Domains Acetyltransf
Protein Families Druggable Genome
Protein Pathways Tyrosine metabolism, Phenylalanine metabolism, Glycerophospholipid metabolism, Limonene and pinene degradation
MW 26.3 kDa
Gene Summary N-alpha-acetylation is among the most common post-translational protein modifications in eukaryotic cells. This process involves the transfer of an acetyl group from acetyl-coenzyme A to the alpha-amino group on a nascent polypeptide and is essential for normal cell function. This gene encodes an N-terminal acetyltransferase that functions as the catalytic subunit of the major amino-terminal acetyltransferase A complex. Mutations in this gene are the cause of Ogden syndrome. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Jan 2012].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)