Caspase-6(CASP6) (NM_001226) Human Tagged ORF Clone

CAT#: RC201349

CASP6 (Myc-DDK-tagged)-Human caspase 6, apoptosis-related cysteine peptidase (CASP6), transcript variant alpha

Change vector?

USD 485


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Caspase-6(CASP6) (NM_001226) Human Tagged ORF Clone
Symbol CASP6
Synonyms MCH2; MCH2
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC201349 representing NM_001226
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGCTCGGCCTCGGGGCTCCGCAGGGGGCACCCGGCAGGTGGGGAAGAAAACATGACAGAAACAGATG
CCTTCTATAAAAGAGAAATGTTTGATCCGGCAGAAAAGTACAAAATGGACCACAGGAGGAGAGGAATTGC
TTTAATCTTCAATCATGAGAGGTTCTTTTGGCACTTAACACTGCCAGAAAGGCGGGGCACCTGCGCAGAT
AGAGACAATCTTACCCGCAGGTTTTCAGATCTAGGATTTGAAGTGAAATGCTTTAATGATCTTAAAGCAG
AAGAACTACTGCTCAAAATTCATGAGGTGTCAACTGTTAGCCACGCAGATGCCGATTGCTTTGTGTGTGT
CTTCCTGAGCCATGGCGAAGGCAATCACATTTATGCATATGATGCTAAAATCGAAATTCAGACATTAACT
GGCTTGTTCAAAGGAGACAAGTGTCACAGCCTGGTTGGAAAACCCAAGATATTTATCATTCAGGCATGTC
GGGGAAACCAGCACGATGTGCCAGTCATTCCTTTGGATGTAGTAGATAATCAGACAGAGAAGTTGGACAC
CAACATAACTGAGGTGGATGCAGCCTCCGTTTACACGCTGCCTGCTGGAGCTGACTTCCTCATGTGTTAC
TCTGTTGCAGAAGGATATTATTCTCACCGGGAAACTGTGAACGGCTCATGGTACATTCAAGATTTGTGTG
AGATGTTGGGAAAATATGGCTCCTCCTTAGAGTTCACAGAACTCCTCACACTGGTGAACAGGAAAGTTTC
TCAGCGCCGAGTGGACTTTTGCAAAGACCCAAGTGCAATTGGAAAGAAGCAGGTTCCCTGTTTTGCCTCA
ATGCTAACTAAAAAGCTGCATTTCTTTCCAAAATCTAAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC201349 representing NM_001226
Red=Cloning site Green=Tags(s)

MSSASGLRRGHPAGGEENMTETDAFYKREMFDPAEKYKMDHRRRGIALIFNHERFFWHLTLPERRGTCAD
RDNLTRRFSDLGFEVKCFNDLKAEELLLKIHEVSTVSHADADCFVCVFLSHGEGNHIYAYDAKIEIQTLT
GLFKGDKCHSLVGKPKIFIIQACRGNQHDVPVIPLDVVDNQTEKLDTNITEVDAASVYTLPAGADFLMCY
SVAEGYYSHRETVNGSWYIQDLCEMLGKYGSSLEFTELLTLVNRKVSQRRVDFCKDPSAIGKKQVPCFAS
MLTKKLHFFPKSN

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001226
ORF Size 879 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001226.1, NM_001226.2, NM_001226.3, NP_001217
RefSeq Size 1661
RefSeq ORF 882
Locus ID 839
Cytogenetics 4q25
Domains CASc, ICE_p10, ICE_p20
Protein Families Protease, Stem cell - Pluripotency, Druggable Genome
Protein Pathways Apoptosis
MW 33.1 kDa
Gene Summary This gene encodes a member of the cysteine-aspartic acid protease (caspase) family of enzymes. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic acid residues to produce two subunits, large and small, that dimerize to form the active enzyme. This protein is processed by caspases 7, 8 and 10, and is thought to function as a downstream enzyme in the caspase activation cascade. Alternative splicing of this gene results in multiple transcript variants that encode different isoforms. [provided by RefSeq, Oct 2015].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations