IFT20 (NM_174887) Human Tagged ORF Clone

CAT#: RC201337

IFT20 (Myc-DDK-tagged)-Human intraflagellar transport 20 homolog (Chlamydomonas) (IFT20)

Product Images

Circular map for RC201337

• 

  Western blot validation of overexpression lysate (Cat# LY406292) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC201337 using transfection reagent MegaTran 2.0 (Cat# TT210002).

• 

  Coomassie blue staining of purified IFT20 protein (Cat# TP301337). The protein was produced from HEK293T cells transfected with IFT20 cDNA clone (Cat# RC201337) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: IFT20
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC201337 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGCCAAGGACATCCTGGGTGAAGCAGGGCTACACTTTGATGAACTGAACAAGCTGAGGGTGTTGGACC
  CAGAGGTTACCCAGCAGACCATAGAGCTGAAGGAAGAGTGCAAAGACTTTGTGGACAAAATTGGCCAGTT
  TCAGAAAATAGTTGGTGGTTTAATTGAGCTTGTTGATCAACTTGCAAAAGAAGCAGAAAATGAAAAGATG
  AAGAGTCTTGCTGTGTCACCCAGGCTGGAGTGCACTGGTGCAATCTCGGCTCACTGCAAGCTCTGCCTCT
  CAGATTCAAGCGATTCTCCCACCTCACCCTCCCGAGTAGGTGGGACTACAGGCCATCGGTGCTCGGAACT
  TGCTCAAATCTATAGCAAAGCAGAGAGAAGCTCAACAGCAGCAACTTCAAGCCCTAATAGCAGAAAAGAA
  AATGCAGCTAGAAAGGTATCGGGT
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC201337 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAKDILGEAGLHFDELNKLRVLDPEVTQQTIELKEECKDFVDKIGQFQKIVGGLIELVDQLAKEAENEKM
  KSLAVSPRLECTGAISAHCKLCLSDSSDSPTSPSRVGGTTGHRCSELAQIYSKAERSSTAATSSPNSRKE
  NAARKVSG
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_174887
• ORF Size: 444 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_174887.4
• RefSeq Size: 1006 bp
• RefSeq ORF: 447 bp
• Locus ID: 90410
• UniProt ID: Q8IY31
• Cytogenetics: 17q11.2
• MW: 16 kDa
• Gene Summary: This gene encodes a intraflagellar transport protein important for intracellular transport. The encoded protein forms part of a complex involved in trafficking of proteins from the Golgi body, including recycling of immune signalling components (Finetti et al., PubMed: 19855387). This gene is part of a complex set of sense-antisense loci that may be co-regulated. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. A pseudogene of this gene is located on the long arm of chromosome 14.[provided by RefSeq, Jun 2012]