NR2F6 (NM_005234) Human Tagged ORF Clone

USD 420.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name NR2F6 (NM_005234) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol NR2F6
Synonyms EAR-2; EAR2; ERBAL2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC201336 representing NM_005234
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCATGGTGACCGGCGGCTGGGGCGGCCCCGGCGGCGACACGAACGGCGTGGACAAGGCGGGCGGCT
ACCCGCGCGCGGCCGAGGACGACTCGGCCTCGCCCCCCGGTGCCGCCAGCGACGCCGAGCCGGGCGACGA
GGAGCGGCCGGGGCTGCAGGTGGACTGCGTGGTGTGCGGGGACAAGTCGAGCGGCAAGCATTACGGTGTC
TTCACCTGCGAGGGCTGCAAGAGCTTTTTCAAGCGAAGCATCCGCCGCAACCTCAGCTACACCTGCCGGT
CCAACCGTGACTGCCAGATCGACCAGCACCACCGGAACCAGTGCCAGTACTGCCGTCTCAAGAAGTGCTT
CCGGGTGGGCATGAGGAAGGAGGCGGTGCAGCGCGGCCGCATCCCGCACTCGCTGCCTGGTGCCGTGGCC
GCCTCCTCGGGCAGCCCCCCGGGCTCGGCGCTGGCGGCAGTGGCGAGCGGCGGAGACCTCTTCCCGGGGC
AGCCGGTGTCCGAACTGATCGCGCAGCTGCTGCGCGCTGAGCCCTACCCTGCGGCGGCCGGACGCTTCGG
CGCAGGGGGCGGCGCGGCGGGCGCGGTGCTGGGCATCGACAACGTGTGCGAGCTGGCGGCGCGGCTGCTC
TTCAGCACCGTGGAGTGGGCGCGCCACGCGCCCTTCTTCCCCGAGCTGCCGGTGGCCGACCAGGTGGCGC
TGCTGCGCCTGAGCTGGAGCGAGCTCTTCGTGCTGAACGCGGCGCAGGCGGCGCTGCCCCTGCACACGGC
GCCGCTACTGGCCGCCGCCGGCCTCCACGCCGCGCCTATGGCCGCCGAGCGCGCCGTGGCTTTCATGGAC
CAGGTGCGCGCCTTCCAGGAGCAGGTGGACAAGCTGGGCCGCCTGCAGGTCGACTCGGCCGAGTATGGCT
GCCTCAAGGCCATCGCGCTCTTCACGCCCGACGCCTGTGGCCTCTCAGACCCGGCCCACGTTGAGAGCCT
GCAGGAGAAGGCGCAGGTGGCCCTCACCGAGTATGTGCGGGCGCAGTACCCGTCCCAGCCCCAGCGCTTC
GGGCGCCTGCTGCTGCGGCTCCCCGCCCTGCGCGCGGTCCCTGCCTCCCTCATCTCCCAGCTGTTCTTCA
TGCGCCTGGTGGGGAAGACGCCCATTGAGACACTGATCAGAGACATGCTGCTGTCGGGGAGTACCTTCAA
CTGGCCCTACGGCTCGGGCCAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC201336 representing NM_005234
Red=Cloning site Green=Tags(s)

MAMVTGGWGGPGGDTNGVDKAGGYPRAAEDDSASPPGAASDAEPGDEERPGLQVDCVVCGDKSSGKHYGV
FTCEGCKSFFKRSIRRNLSYTCRSNRDCQIDQHHRNQCQYCRLKKCFRVGMRKEAVQRGRIPHSLPGAVA
ASSGSPPGSALAAVASGGDLFPGQPVSELIAQLLRAEPYPAAAGRFGAGGGAAGAVLGIDNVCELAARLL
FSTVEWARHAPFFPELPVADQVALLRLSWSELFVLNAAQAALPLHTAPLLAAAGLHAAPMAAERAVAFMD
QVRAFQEQVDKLGRLQVDSAEYGCLKAIALFTPDACGLSDPAHVESLQEKAQVALTEYVRAQYPSQPQRF
GRLLLRLPALRAVPASLISQLFFMRLVGKTPIETLIRDMLLSGSTFNWPYGSGQ

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_005234
ORF Size 1212 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_005234.3, NP_005225.2
RefSeq Size 1804 bp
RefSeq ORF 1215 bp
Locus ID 2063
Cytogenetics 19p13.11
Domains HOLI, zf-C4
Protein Families Druggable Genome, Nuclear Hormone Receptor, Transcription Factors
MW 42.8 kDa
Gene Summary Transcription factor predominantly involved in transcriptional repression. Binds to promoter/enhancer response elements that contain the imperfect 5'-AGGTCA-3' direct or inverted repeats with various spacings which are also recognized by other nuclear hormone receptors. Involved in modulation of hormonal responses. Represses transcriptional activity of the lutropin-choriogonadotropic hormone receptor/LHCGR gene, the renin/REN gene and the oxytocin-neurophysin/OXT gene. Represses the triiodothyronine-dependent and -independent transcriptional activity of the thyroid hormone receptor gene in a cell type-specific manner. The corepressing function towards thyroid hormone receptor beta/THRB involves at least in part the inhibition of THRB binding to triiodothyronine response elements (TREs) by NR2F6. Inhibits NFATC transcription factor DNA binding and subsequently its transcriptional activity. Acts as transcriptional repressor of IL-17 expression in Th-17 differentiated CD4(+) T cells and may be involved in induction and/or maintenance of peripheral immunological tolerance and autoimmunity. Involved in development of forebrain circadian clock; is required early in the development of the locus coeruleus (LC). [UniProtKB/Swiss-Prot Function]

Citations (1)

Other Versions

Other products for "NR2F6"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


NR2F6 mouse monoclonal antibody, clone OTI2H4 (formerly 2H4)
    • 100 ul

USD 379.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools