NR2F6 (NM_005234) Human Tagged ORF Clone

CAT#: RC201336

NR2F6 (Myc-DDK-tagged)-Human nuclear receptor subfamily 2, group F, member 6 (NR2F6)

Product Images

Circular map for RC201336

• 

  HEK293T cells were transfected with the pCMV6-ENTRY control (Cat# PS100001, Left lane) or pCMV6-ENTRY NR2F6 (Cat# RC201336, Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-NR2F6(Cat# TA806787). Positive lysates LY401603 (100ug) and LC401603 (20ug) can be purchased separately from OriGene.

• 

  Western blot validation of overexpression lysate (Cat# LY401603) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC201336 using transfection reagent MegaTran 2.0 (Cat# TT210002).

• 

  Coomassie blue staining of purified NR2F6 protein (Cat# TP301336). The protein was produced from HEK293T cells transfected with NR2F6 cDNA clone (Cat# RC201336) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: NR2F6
• Synonyms: EAR-2; EAR2; ERBAL2
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC201336 representing NM_005234
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGCCATGGTGACCGGCGGCTGGGGCGGCCCCGGCGGCGACACGAACGGCGTGGACAAGGCGGGCGGCT
  ACCCGCGCGCGGCCGAGGACGACTCGGCCTCGCCCCCCGGTGCCGCCAGCGACGCCGAGCCGGGCGACGA
  GGAGCGGCCGGGGCTGCAGGTGGACTGCGTGGTGTGCGGGGACAAGTCGAGCGGCAAGCATTACGGTGTC
  TTCACCTGCGAGGGCTGCAAGAGCTTTTTCAAGCGAAGCATCCGCCGCAACCTCAGCTACACCTGCCGGT
  CCAACCGTGACTGCCAGATCGACCAGCACCACCGGAACCAGTGCCAGTACTGCCGTCTCAAGAAGTGCTT
  CCGGGTGGGCATGAGGAAGGAGGCGGTGCAGCGCGGCCGCATCCCGCACTCGCTGCCTGGTGCCGTGGCC
  GCCTCCTCGGGCAGCCCCCCGGGCTCGGCGCTGGCGGCAGTGGCGAGCGGCGGAGACCTCTTCCCGGGGC
  AGCCGGTGTCCGAACTGATCGCGCAGCTGCTGCGCGCTGAGCCCTACCCTGCGGCGGCCGGACGCTTCGG
  CGCAGGGGGCGGCGCGGCGGGCGCGGTGCTGGGCATCGACAACGTGTGCGAGCTGGCGGCGCGGCTGCTC
  TTCAGCACCGTGGAGTGGGCGCGCCACGCGCCCTTCTTCCCCGAGCTGCCGGTGGCCGACCAGGTGGCGC
  TGCTGCGCCTGAGCTGGAGCGAGCTCTTCGTGCTGAACGCGGCGCAGGCGGCGCTGCCCCTGCACACGGC
  GCCGCTACTGGCCGCCGCCGGCCTCCACGCCGCGCCTATGGCCGCCGAGCGCGCCGTGGCTTTCATGGAC
  CAGGTGCGCGCCTTCCAGGAGCAGGTGGACAAGCTGGGCCGCCTGCAGGTCGACTCGGCCGAGTATGGCT
  GCCTCAAGGCCATCGCGCTCTTCACGCCCGACGCCTGTGGCCTCTCAGACCCGGCCCACGTTGAGAGCCT
  GCAGGAGAAGGCGCAGGTGGCCCTCACCGAGTATGTGCGGGCGCAGTACCCGTCCCAGCCCCAGCGCTTC
  GGGCGCCTGCTGCTGCGGCTCCCCGCCCTGCGCGCGGTCCCTGCCTCCCTCATCTCCCAGCTGTTCTTCA
  TGCGCCTGGTGGGGAAGACGCCCATTGAGACACTGATCAGAGACATGCTGCTGTCGGGGAGTACCTTCAA
  CTGGCCCTACGGCTCGGGCCAG
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC201336 representing NM_005234
  Red=Cloning site Green=Tags(s)
  
  MAMVTGGWGGPGGDTNGVDKAGGYPRAAEDDSASPPGAASDAEPGDEERPGLQVDCVVCGDKSSGKHYGV
  FTCEGCKSFFKRSIRRNLSYTCRSNRDCQIDQHHRNQCQYCRLKKCFRVGMRKEAVQRGRIPHSLPGAVA
  ASSGSPPGSALAAVASGGDLFPGQPVSELIAQLLRAEPYPAAAGRFGAGGGAAGAVLGIDNVCELAARLL
  FSTVEWARHAPFFPELPVADQVALLRLSWSELFVLNAAQAALPLHTAPLLAAAGLHAAPMAAERAVAFMD
  QVRAFQEQVDKLGRLQVDSAEYGCLKAIALFTPDACGLSDPAHVESLQEKAQVALTEYVRAQYPSQPQRF
  GRLLLRLPALRAVPASLISQLFFMRLVGKTPIETLIRDMLLSGSTFNWPYGSGQ
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_005234
• ORF Size: 1212 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_005234.3, NP_005225.2
• RefSeq Size: 1804 bp
• RefSeq ORF: 1215 bp
• Locus ID: 2063
• UniProt ID: P10588
• Cytogenetics: 19p13.11
• Domains: HOLI, zf-C4
• Protein Families: Druggable Genome, Nuclear Hormone Receptor, Transcription Factors
• MW: 42.8 kDa
• Gene Summary: Transcription factor predominantly involved in transcriptional repression. Binds to promoter/enhancer response elements that contain the imperfect 5'-AGGTCA-3' direct or inverted repeats with various spacings which are also recognized by other nuclear hormone receptors. Involved in modulation of hormonal responses. Represses transcriptional activity of the lutropin-choriogonadotropic hormone receptor/LHCGR gene, the renin/REN gene and the oxytocin-neurophysin/OXT gene. Represses the triiodothyronine-dependent and -independent transcriptional activity of the thyroid hormone receptor gene in a cell type-specific manner. The corepressing function towards thyroid hormone receptor beta/THRB involves at least in part the inhibition of THRB binding to triiodothyronine response elements (TREs) by NR2F6. Inhibits NFATC transcription factor DNA binding and subsequently its transcriptional activity. Acts as transcriptional repressor of IL-17 expression in Th-17 differentiated CD4(+) T cells and may be involved in induction and/or maintenance of peripheral immunological tolerance and autoimmunity. Involved in development of forebrain circadian clock; is required early in the development of the locus coeruleus (LC).[UniProtKB/Swiss-Prot Function]