Asparagine synthetase(ASNS) (NM_001673) Human Tagged ORF Clone

CAT#: RC201297

ASNS (Myc-DDK-tagged)-Human asparagine synthetase (glutamine-hydrolyzing) (ASNS), transcript variant 2

Change vector?

USD 577


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Asparagine synthetase(ASNS) (NM_001673) Human Tagged ORF Clone
Symbol ASNS
Synonyms ASNSD; TS11
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC201297 representing NM_001673
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTGTGGCATTTGGGCGCTGTTTGGCAGTGATGATTGCCTTTCTGTTCAGTGTCTGAGTGCTATGAAGA
TTGCACACAGAGGTCCAGATGCATTCCGTTTTGAGAATGTCAATGGATACACCAACTGCTGCTTTGGATT
TCACCGGTTGGCGGTAGTTGACCCGCTGTTTGGAATGCAGCCAATTCGAGTGAAGAAATATCCGTATTTG
TGGCTCTGTTACAATGGTGAAATCTACAACCATAAGAAGATGCAACAGCATTTTGAATTTGAATACCAGA
CCAAAGTGGATGGTGAGATAATCCTTCATCTTTATGACAAAGGAGGAATTGAGCAAACAATTTGTATGTT
GGATGGTGTGTTTGCATTTGTTTTACTGGATACTGCCAATAAGAAAGTGTTCCTGGGTAGAGATACATAT
GGAGTCAGACCTTTGTTTAAAGCAATGACAGAAGATGGATTTTTGGCTGTATGTTCAGAAGCTAAAGGTC
TTGTTACATTGAAGCACTCCGCGACTCCCTTTTTAAAAGTGGAGCCTTTTCTTCCTGGACACTATGAAGT
TTTGGATTTAAAGCCAAATGGCAAAGTTGCATCCGTGGAAATGGTTAAATATCATCACTGTCGGGATGTA
CCCCTGCACGCCCTCTATGACAATGTGGAGAAACTCTTTCCAGGTTTTGAGATAGAAACTGTGAAGAACA
ACCTCAGGATCCTTTTTAATAATGCTGTAAAGAAACGTTTGATGACAGACAGAAGGATTGGCTGCCTTTT
ATCAGGGGGCTTGGACTCCAGCTTGGTTGCTGCCACTCTGTTGAAGCAGCTGAAAGAAGCCCAAGTACAG
TATCCTCTCCAGACATTTGCAATTGGCATGGAAGACAGCCCCGATTTACTGGCTGCTAGAAAGGTGGCAG
ATCATATTGGAAGTGAACATTATGAAGTCCTTTTTAACTCTGAGGAAGGCATTCAGGCTCTGGATGAAGT
CATATTTTCCTTGGAAACTTATGACATTACAACAGTTCGTGCTTCAGTAGGTATGTATTTAATTTCCAAG
TATATTCGGAAGAACACAGATAGCGTGGTGATCTTCTCTGGAGAAGGATCAGATGAACTTACGCAGGGTT
ACATATATTTTCACAAGGCTCCTTCTCCTGAAAAAGCCGAGGAGGAGAGTGAGAGGCTTCTGAGGGAACT
CTATTTGTTTGATGTTCTCCGCGCAGATCGAACTACTGCTGCCCATGGTCTTGAACTGAGAGTCCCATTT
CTAGATCATCGATTTTCTTCCTATTACTTGTCTCTGCCACCAGAAATGAGAATTCCAAAGAATGGGATAG
AAAAACATCTCCTGAGAGAGACGTTTGAGGATTCCAATCTGATACCCAAAGAGATTCTCTGGCGACCAAA
AGAAGCCTTCAGTGATGGAATAACTTCAGTTAAGAATTCCTGGTTTAAGATTTTACAGGAATACGTTGAA
CATCAGGTTGATGATGCAATGATGGCAAATGCAGCCCAGAAATTTCCCTTCAATACTCCTAAAACCAAAG
AAGGATATTACTACCGTCAAGTCTTTGAACGCCATTACCCAGGCCGGGCTGACTGGCTGAGCCATTACTG
GATGCCCAAGTGGATCAATGCCACTGACCCTTCTGCCCGCACGCTGACCCACTACAAGTCAGCTGTCAAA
GCT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC201297 representing NM_001673
Red=Cloning site Green=Tags(s)

MCGIWALFGSDDCLSVQCLSAMKIAHRGPDAFRFENVNGYTNCCFGFHRLAVVDPLFGMQPIRVKKYPYL
WLCYNGEIYNHKKMQQHFEFEYQTKVDGEIILHLYDKGGIEQTICMLDGVFAFVLLDTANKKVFLGRDTY
GVRPLFKAMTEDGFLAVCSEAKGLVTLKHSATPFLKVEPFLPGHYEVLDLKPNGKVASVEMVKYHHCRDV
PLHALYDNVEKLFPGFEIETVKNNLRILFNNAVKKRLMTDRRIGCLLSGGLDSSLVAATLLKQLKEAQVQ
YPLQTFAIGMEDSPDLLAARKVADHIGSEHYEVLFNSEEGIQALDEVIFSLETYDITTVRASVGMYLISK
YIRKNTDSVVIFSGEGSDELTQGYIYFHKAPSPEKAEEESERLLRELYLFDVLRADRTTAAHGLELRVPF
LDHRFSSYYLSLPPEMRIPKNGIEKHLLRETFEDSNLIPKEILWRPKEAFSDGITSVKNSWFKILQEYVE
HQVDDAMMANAAQKFPFNTPKTKEGYYYRQVFERHYPGRADWLSHYWMPKWINATDPSARTLTHYKSAVK
A

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001673
ORF Size 1683 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001673.1, NM_001673.2, NM_001673.3, NM_001673.4, NP_001664
RefSeq Size 1994
RefSeq ORF 1686
Locus ID 440
Cytogenetics 7q21.3
Domains GATase_2, Asn_synthase
Protein Families Druggable Genome
Protein Pathways Alanine, aspartate and glutamate metabolism, Nitrogen metabolism, Metabolic pathways
MW 64.2 kDa
Gene Summary The protein encoded by this gene is involved in the synthesis of asparagine. This gene complements a mutation in the temperature-sensitive hamster mutant ts11, which blocks progression through the G1 phase of the cell cycle at nonpermissive temperature. Alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, May 2010].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations