UBA2 (NM_005499) Human Tagged ORF Clone

CAT#: RC201288

Reviews ()
Write a review

UBA2 (Myc-DDK-tagged)-Human ubiquitin-like modifier activating enzyme 2 (UBA2)



Reconstitution Protocol

USD 596.00

In Stock*

Size
    • 10 ug

Product images

Other products for "UBA2"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol UBA2
Synonyms ARX; HRIHFB2115; SAE2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC201288 representing NM_005499
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCACTGTCGCGGGGGCTGCCCCGGGAGCTGGCTGAGGCGGTGGCCGGGGGCCGGGTGCTGGTGGTGG
GGGCGGGCGGCATCGGCTGCGAGCTCCTCAAGAATCTCGTGCTCACCGGTTTCTCCCACATCGACCTGAT
TGATCTGGATACTATTGATGTAAGCAACCTCAACAGACAGTTTTTGTTTCAAAAGAAACATGTTGGAAGA
TCAAAGGCACAGGTTGCCAAGGAAAGTGTACTGCAGTTTTACCCGAAAGCTAATATCGTTGCCTACCATG
ACAGCATCATGAACCCTGACTATAATGTGGAATTTTTCCGACAGTTTATACTGGTTATGAATGCTTTAGA
TAACAGAGCTGCCCGAAACCATGTTAATAGAATGTGCCTGGCAGCTGATGTTCCTCTTATTGAAAGTGGA
ACAGCTGGGTATCTTGGACAAGTAACTACTATCAAAAAGGGTGTGACCGAGTGTTATGAGTGTCATCCTA
AGCCGACCCAGAGAACCTTTCCTGGCTGTACAATTCGTAACACACCTTCAGAACCTATACATTGCATCGT
TTGGGCAAAGTACTTGTTCAACCAGTTGTTTGGGGAAGAAGATGCTGATCAAGAAGTATCTCCTGACAGA
GCTGACCCTGAAGCTGCCTGGGAACCAACGGAAGCCGAAGCCAGAGCTAGAGCATCTAATGAAGATGGTG
ACATTAAACGTATTTCTACTAAGGAATGGGCTAAATCAACTGGATATGATCCAGTTAAACTTTTTACCAA
GCTTTTTAAAGATGACATCAGGTATCTGTTGACAATGGACAAACTATGGCGGAAAAGGAAACCTCCAGTT
CCGTTGGACTGGGCTGAAGTACAAAGTCAAGGAGAAGAAACGAATGCATCAGATCAACAGAATGAACCCC
AGTTAGGCCTGAAAGACCAGCAGGTTCTAGATGTAAAGAGCTATGCACGTCTTTTTTCAAAGAGCATCGA
GACTTTGAGAGTTCATTTAGCAGAAAAGGGGGATGGAGCTGAGCTCATATGGGATAAGGATGACCCATCT
GCAATGGATTTTGTCACCTCTGCTGCAAACCTCAGGATGCATATTTTCAGTATGAATATGAAGAGTAGAT
TTGATATCAAATCAATGGCAGGGAACATTATTCCTGCTATTGCTACTACTAATGCAGTAATTGCTGGGTT
GATAGTATTGGAAGGATTGAAGATTTTATCAGGAAAAATAGACCAGTGCAGAACAATTTTTTTGAATAAA
CAACCAAACCCAAGAAAGAAGCTTCTTGTGCCTTGTGCACTGGATCCTCCCAACCCCAATTGTTATGTAT
GTGCCAGCAAGCCAGAGGTGACTGTGCGGCTGAATGTCCATAAAGTGACTGTTCTCACCTTACAAGACAA
GATAGTGAAAGAAAAATTTGCTATGGTAGCACCAGATGTCCAAATTGAAGATGGGAAAGGAACAATCCTA
ATATCTTCCGAAGAGGGAGAGACGGAAGCTAATAATCACAAGAAGTTGTCAGAATTTGGAATTAGAAATG
GCAGCCGGCTTCAAGCAGATGACTTCCTCCAGGACTATACTTTATTGATCAACATCCTTCATAGTGAAGA
CCTAGGAAAGGACGTTGAATTTGAAGTTGTTGGTGATGCCCCGGAAAAAGTGGGGCCCAAACAAGCTGAA
GATGCTGCCAAAAGCATAACCAATGGCAGTGATGATGGAGCTCAGCCCTCCACCTCCACAGCTCAAGAGC
AAGATGACGTTCTCATAGTTGATTCGGATGAAGAAGATTCTTCAAATAATGCCGACGTCAGTGAAGAAGA
GAGAAGCCGCAAGAGGAAATTAGATGAGAAAGAGAATCTCAGTGCAAAGAGGTCACGTATAGAACAGAAG
GAAGAGCTTGATGATGTCATAGCATTAGAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC201288 representing NM_005499
Red=Cloning site Green=Tags(s)

MALSRGLPRELAEAVAGGRVLVVGAGGIGCELLKNLVLTGFSHIDLIDLDTIDVSNLNRQFLFQKKHVGR
SKAQVAKESVLQFYPKANIVAYHDSIMNPDYNVEFFRQFILVMNALDNRAARNHVNRMCLAADVPLIESG
TAGYLGQVTTIKKGVTECYECHPKPTQRTFPGCTIRNTPSEPIHCIVWAKYLFNQLFGEEDADQEVSPDR
ADPEAAWEPTEAEARARASNEDGDIKRISTKEWAKSTGYDPVKLFTKLFKDDIRYLLTMDKLWRKRKPPV
PLDWAEVQSQGEETNASDQQNEPQLGLKDQQVLDVKSYARLFSKSIETLRVHLAEKGDGAELIWDKDDPS
AMDFVTSAANLRMHIFSMNMKSRFDIKSMAGNIIPAIATTNAVIAGLIVLEGLKILSGKIDQCRTIFLNK
QPNPRKKLLVPCALDPPNPNCYVCASKPEVTVRLNVHKVTVLTLQDKIVKEKFAMVAPDVQIEDGKGTIL
ISSEEGETEANNHKKLSEFGIRNGSRLQADDFLQDYTLLINILHSEDLGKDVEFEVVGDAPEKVGPKQAE
DAAKSITNGSDDGAQPSTSTAQEQDDVLIVDSDEEDSSNNADVSEEERSRKRKLDEKENLSAKRSRIEQK
EELDDVIALD

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_005499
ORF Size 1920 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_005499.1
RefSeq Size 2682 bp
RefSeq ORF 1923 bp
Locus ID 10054
UniProt ID Q9UBT2
Cytogenetics 19q13.11
Domains UBACT, ThiF
Protein Pathways Ubiquitin mediated proteolysis
MW 71 kDa
Gene Summary Posttranslational modification of proteins by the addition of the small protein SUMO (see SUMO1; MIM 601912), or sumoylation, regulates protein structure and intracellular localization. SAE1 (MIM 613294) and UBA2 form a heterodimer that functions as a SUMO-activating enzyme for the sumoylation of proteins (Okuma et al., 1999 [PubMed 9920803]).[supplied by OMIM, Mar 2010]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.