PSMC5 (NM_002805) Human Tagged ORF Clone

CAT#: RC201251

PSMC5 (Myc-DDK-tagged)-Human proteasome (prosome, macropain) 26S subunit, ATPase, 5 (PSMC5), transcript variant 1

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK DDK w/ Puro mGFP mGFP w/ Puro

AAV Particle: DDK


  "NM_002805" in other vectors (6)

Reconstitution Protocol

Special Offer: 20% off this product. Use code: "Clone20".

USD 457.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


Rabbit Polyclonal Anti-PSMC5 Antibody
    • 100 ul

USD 485.00

Other products for "PSMC5"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol PSMC5
Synonyms p45; p45/SUG; RPT6; S8; SUG-1; SUG1; TBP10; TRIP1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC201251 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGCTTGACGGACCAGAGCAGATGGAGCTGGAGGAGGGGAAGGCAGGCAGCGGACTCCGCCAATATT
ATCTGTCCAAGATTGAAGAACTCCAGCTGATTGTGAATGATAAGAGCCAAAACCTCCGGAGGCTGCAGGC
ACAGAGGAACGAACTAAATGCTAAAGTTCGCCTATTGCGGGAGGAGCTACAGCTGCTGCAGGAGCAGGGC
TCCTATGTGGGGGAAGTAGTCCGGGCCATGGATAAGAAGAAAGTGTTGGTCAAGGTACATCCTGAAGGTA
AATTTGTTGTAGACGTGGACAAAAACATTGACATCAATGATGTGACACCCAATTGCCGGGTGGCTCTAAG
GAATGACAGCTACACTCTGCACAAGATCCTGCCCAACAAGGTAGACCCATTAGTGTCACTGATGATGGTG
GAGAAAGTACCAGATTCAACTTATGAGATGATTGGTGGACTGGACAAACAGATCAAGGAGATCAAAGAAG
TGATCGAGCTGCCTGTTAAGCATCCTGAGCTCTTCGAAGCACTGGGCATTGCTCAGCCCAAGGGAGTGCT
GCTGTATGGACCTCCAGGCACTGGGAAGACACTGTTGGCCCGGGCTGTGGCTCATCATACGGACTGTACC
TTTATTCGTGTCTCTGGCTCTGAACTGGTACAGAAATTCATAGGGGAAGGGGCAAGAATGGTGAGGGAGC
TGTTTGTCATGGCACGGGAACATGCTCCATCTATCATCTTCATGGACGAAATCGACTCCATCGGCTCCTC
GCGGCTGGAGGGGGGTTCTGGAGGGGACAGTGAAGTGCAGCGCACGATGCTGGAGTTGCTCAACCAGCTC
GACGGCTTTGAGGCCACCAAGAACATCAAGGTTATCATGGCTACTAATAGGATTGATATCCTGGACTCGG
CACTGCTTCGCCCAGGGCGCATTGACAGAAAAATTGAATTCCCACCCCCCAATGAGGAGGCCCGGCTGGA
CATTTTGAAGATTCATTCTCGGAAGATGAACCTGACCCGGGGGATCAACCTGAGAAAAATTGCTGAGCTC
ATGCCAGGAGCATCAGGGGCTGAAGTGAAGGGCGTGTGCACAGAAGCTGGCATGTATGCCCTGCGAGAAC
GGCGAGTCCATGTCACTCAGGAGGACTTTGAGATGGCAGTAGCCAAGGTCATGCAGAAGGACAGTGAGAA
AAACATGTCCATCAAGAAATTATGGAAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC201251 protein sequence
Red=Cloning site Green=Tags(s)

MALDGPEQMELEEGKAGSGLRQYYLSKIEELQLIVNDKSQNLRRLQAQRNELNAKVRLLREELQLLQEQG
SYVGEVVRAMDKKKVLVKVHPEGKFVVDVDKNIDINDVTPNCRVALRNDSYTLHKILPNKVDPLVSLMMV
EKVPDSTYEMIGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCT
FIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQL
DGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAEL
MPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLWK

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_002805
ORF Size 1218 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_002805.6
RefSeq Size 1372 bp
RefSeq ORF 1221 bp
Locus ID 5705
UniProt ID P62195
Cytogenetics 17q23.3
Domains AAA, AAA
Protein Families Druggable Genome
Protein Pathways Proteasome
MW 45.6 kDa
Gene Summary The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes one of the ATPase subunits, a member of the triple-A family of ATPases which have a chaperone-like activity. In addition to participation in proteasome functions, this subunit may participate in transcriptional regulation since it has been shown to interact with the thyroid hormone receptor and retinoid X receptor-alpha. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2010]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.