HIGD2A (NM_138820) Human Tagged ORF Clone

CAT#: RC201223

Reviews ()
Write a review

HIGD2A (Myc-DDK-tagged)-Human HIG1 hypoxia inducible domain family, member 2A (HIGD2A)



  "NM_138820" in other vectors (4)

Special Offer: 20% off on control vector. Use code "Shuttle20".

USD 118.00

USD 429.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol HIGD2A
Synonyms RCF1b
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC201223 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGACTCCCGGCCCTGTGATTCCGGAGGTCCCCTTTGAACCATCGAAGCCTCCAGTCATTGAGGGGC
TGAGCCCCACTGTTTACAGGAATCCAGAGAGTTTCAAGGAAAAGTTCGTTCGCAAGACCCGCGAGAACCC
GGTGGTACCCATAGGTTGCCTGGCCACGGCGGCCGCCCTCACCTACGGCCTCTACTCCTTCCACCGGGGC
AACAGCCAGCGCTCTCAGCTCATGATGCGCACCCGGATCGCCGCCCAGGGTTTCACGGTCGCAGCCATCT
TGCTGGGTCTGGCTGTCACTGCTATGAAGTCTCGACCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC201223 protein sequence
Red=Cloning site Green=Tags(s)

MATPGPVIPEVPFEPSKPPVIEGLSPTVYRNPESFKEKFVRKTRENPVVPIGCLATAAALTYGLYSFHRG
NSQRSQLMMRTRIAAQGFTVAAILLGLAVTAMKSRP

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_138820
ORF Size 318 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_138820.4
RefSeq Size 628 bp
RefSeq ORF 321 bp
Locus ID 192286
UniProt ID Q9BW72
Cytogenetics 5q35.2
Domains HIG_1_N
Protein Families Transmembrane
MW 11.5 kDa
Gene Summary The protein encoded by this gene is a subunit of the cytochrome c oxidase complex (complex IV), which is the terminal enzyme in the mitochondrial respiratory chain. The encoded protein is an inner mitochondrial membrane protein and is a functional ortholog of the yeast respiratory supercomplex factor 1 (Rcf1). In mouse, the orthologous protein enhances cell survival under conditions of hypoxia. [provided by RefSeq, Sep 2016]

Other Versions

Other products for "HIGD2A"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


HIGD2A Antibody - N-terminal region
    • 100 ul

USD 475.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.