Pumilio 1 (PUM1) (NM_014676) Human Tagged ORF Clone

CAT#: RC201219

Reviews ()
Write a review

PUM1 (Myc-DDK-tagged)-Human pumilio homolog 1 (Drosophila) (PUM1), transcript variant 2



Reconstitution Protocol

USD 1,032.00

USD 1,548.00

In Stock*

Size
    • 10 ug

Product images

Other products for "PUM1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol PUM1
Synonyms HSPUM; PUMH; PUMH1; PUML1; SCA47
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC201219 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGCGTTGCATGTGTCTTGAAGAGAAAAGCAGTGCTTTGGCAGGACTCTTTCAGCCCCCACCTGAAAC
ATCACCCTCAAGAACCAGCTAATCCCAACATGCCTGTTGTTTTGACATCTGGAACAGGGTCGCAAGCGCA
GCCACAACCAGCTGCAAATCAGGCTCTTGCAGCTGGGACTCACTCCAGCCCTGTCCCAGGATCTATAGGA
GTTGCAGGCCGTTCCCAGGACGACGCTATGGTGGACTACTTCTTTCAGAGGCAGCATGGTGAGCAGCTTG
GGGGAGGAGGAAGTGGAGGAGGCGGCTATAATAATAGCAAACATCGATGGCCTACTGGGGATAACATTCA
TGCAGAACATCAGGTGCGTTCCATGGATGAACTGAATCATGATTTTCAAGCACTTGCTCTGGAGGGAAGA
GCGATGGGAGAGCAGCTCTTGCCAGGTAAAAAGTTTTGGGAAACAGATGAATCCAGCAAAGATGGACCAA
AAGGAATATTCCTGGGTGATCAATGGCGAGACAGTGCCTGGGGAACATCAGATCATTCAGTTTCCCAGCC
AATCATGGTGCAGAGAAGACCTGGTCAGAGTTTCCATGTGAACAGTGAGGTCAATTCTGTACTGTCCCCA
CGATCGGAGAGTGGGGGACTAGGCGTTAGCATGGTGGAGTATGTGTTGAGCTCATCCCCGGGCGATTCCT
GTCTAAGAAAAGGAGGATTTGGCCCAAGGGATGCAGACAGTGATGAAAACGACAAAGGTGAAAAGAAGAA
CAAGGGTACGTTTGATGGAGATAAGCTAGGAGATTTGAAGGAGGAGGGTGATGTGATGGACAAGACCAAT
GGTTTACCAGTGCAGAATGGGATTGATGCAGACGTCAAAGATTTTAGCCGTACCCCTGGTAATTGCCAGA
ACTCTGCTAATGAAGTGGATCTTCTGGGTCCAAACCAGAATGGTTCTGAGGGCTTAGCCCAGCTGACCAG
CACCAATGGTGCCAAGCCTGTGGAGGATTTCTCCAACATGGAGTCCCAGAGTGTCCCCTTGGACCCCATG
GAACATGTGGGCATGGAGCCTCTTCAGTTTGATTATTCAGGCACGCAGGTACCTGTGGACTCAGCAGCAG
CAACTGTGGGACTTTTTGACTACAATTCTCAACAACAGCTGTTCCAAAGACCTAATGCGCTTGCTGTCCA
GCAGTTGACAGCTGCTCAGCAGCAGCAGTATGCACTGGCAGCTGCTCATCAGCCGCACATCGGTTTAGCT
CCCGCTGCGTTTGTCCCCAATCCATACATCATCAGCGCTGCTCCCCCAGGGACGGACCCCTACACAGCTG
GATTGGCTGCAGCAGCGACACTAGGCCCAGCTGTGGTCCCTCACCAGTATTATGGAGTTACTCCCTGGGG
AGTCTACCCTGCCAGTCTTTTCCAGCAGCAAGCTGCCGCTGCCGCTGCAGCAACTAATTCAGCTAATCAA
CAGACCACCCCACAGGCTCAGCAAGGACAGCAGCAGGTTCTCCGTGGAGGAGCCAGCCAACGTCCTTTGA
CCCCAAACCAGAACCAGCAGGGACAGCAAACGGATCCCCTTGTGGCAGCTGCAGCAGTGAATTCTGCCCT
TGCATTTGGACAAGGTCTGGCAGCAGGCATGCCAGGTTATCCGGTGTTGGCTCCTGCTGCTTACTATGAC
CAAACTGGTGCCCTTGTAGTGAATGCAGGCGCGAGAAATGGTCTTGGAGCTCCTGTTCGACTTGTAGCTC
CTGCCCCAGTCATCATTAGTTCCTCAGCTGCACAAGCAGCTGTTGCAGCAGCCGCAGCTTCAGCAAATGG
AGCAGCTGGTGGTCTTGCTGGAACAACAAATGGACCATTTCGCCCTTTAGGAACACAGCAGCCTCAGCCC
CAGCCCCAGCAGCAGCCCAATAACAACCTGGCATCCAGTTCTTTCTACGGCAACAACTCTCTGAACAGCA
ATTCACAGAGCAGCTCCCTCTTCTCCCAGGGCTCTGCCCAGCCTGCCAACACATCCTTGGGATTCGGAAG
TAGCAGTTCTCTCGGCGCCACCCTGGGATCCGCCCTTGGAGGGTTTGGAACAGCAGTTGCAAACTCCAAC
ACTGGCAGTGGCTCCCGCCGTGACTCCCTGACTGGCAGCAGTGACCTTTATAAGAGGACATCGAGCAGCT
TGACCCCCATTGGACACAGTTTTTATAACGGCCTTAGCTTTTCCTCCTCTCCTGGACCCGTGGGCATGCC
TCTCCCTAGTCAGGGACCAGGACATTCACAGACACCACCTCCTTCCCTCTCTTCACATGGATCCTCTTCA
AGCTTAAACCTGGGAGGACTCACGAACGGCAGTGGAAGATACATCTCTGCTGCTCCAGGCGCTGAAGCCA
AGTACCGCAGTGCAAGCAGCGCCTCCAGCCTCTTCAGCCCGAGCAGCACTCTTTTCTCTTCCTCTCGTTT
GCGATATGGAATGTCTGATGTCATGCCTTCTGGCAGGAGCAGGCTTTTGGAAGATTTTCGAAACAACCGG
TACCCCAATTTACAACTGCGGGAGATTGCTGGACATATAATGGAATTTTCCCAAGACCAGCATGGGTCCA
GATTCATTCAGCTGAAACTGGAGCGTGCCACACCAGCTGAGCGCCAGCTTGTCTTCAATGAAATCCTCCA
GGCTGCCTACCAACTCATGGTGGATGTGTTTGGTAATTACGTCATTCAGAAGTTCTTTGAATTTGGCAGT
CTTGAACAGAAGCTGGCTTTGGCAGAACGGATTCGAGGCCACGTCCTGTCATTGGCACTACAGATGTATG
GCTGCCGTGTTATCCAGAAAGCTCTTGAGTTTATTCCTTCAGACCAGCAGAATGAGATGGTTCGGGAACT
AGATGGCCATGTCTTGAAGTGTGTGAAAGATCAGAATGGCAATCACGTGGTTCAGAAATGCATTGAATGT
GTACAGCCCCAGTCTTTGCAATTTATCATCGATGCGTTTAAGGGACAGGTATTTGCCTTATCCACACATC
CTTATGGCTGCCGAGTGATTCAGAGAATCCTGGAGCACTGTCTCCCTGACCAGACACTCCCTATTTTAGA
GGAGCTTCACCAGCACACAGAGCAGCTTGTACAGGATCAATATGGAAATTATGTAATCCAACATGTACTG
GAGCACGGTCGTCCTGAGGATAAAAGCAAAATTGTAGCAGAAATCCGAGGCAATGTACTTGTATTGAGTC
AGCACAAATTTGCAAGCAATGTTGTGGAGAAGTGTGTTACTCACGCCTCACGTACGGAGCGCGCTGTGCT
CATCGATGAGGTGTGCACCATGAACGACGGTCCCCACAGTGCCTTATACACCATGATGAAGGACCAGTAT
GCCAACTACGTGGTCCAGAAGATGATTGACGTGGCGGAGCCAGGCCAGCGGAAGATCGTCATGCATAAGA
TCCGGCCCCACATCGCAACTCTTCGTAAGTACACCTATGGCAAGCACATTCTGGCCAAGCTGGAGAAGTA
CTACATGAAGAACGGTGTTGACTTAGGGCCCATCTGTGGCCCCCCTAATGGTATCATC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC201219 protein sequence
Red=Cloning site Green=Tags(s)

MSVACVLKRKAVLWQDSFSPHLKHHPQEPANPNMPVVLTSGTGSQAQPQPAANQALAAGTHSSPVPGSIG
VAGRSQDDAMVDYFFQRQHGEQLGGGGSGGGGYNNSKHRWPTGDNIHAEHQVRSMDELNHDFQALALEGR
AMGEQLLPGKKFWETDESSKDGPKGIFLGDQWRDSAWGTSDHSVSQPIMVQRRPGQSFHVNSEVNSVLSP
RSESGGLGVSMVEYVLSSSPGDSCLRKGGFGPRDADSDENDKGEKKNKGTFDGDKLGDLKEEGDVMDKTN
GLPVQNGIDADVKDFSRTPGNCQNSANEVDLLGPNQNGSEGLAQLTSTNGAKPVEDFSNMESQSVPLDPM
EHVGMEPLQFDYSGTQVPVDSAAATVGLFDYNSQQQLFQRPNALAVQQLTAAQQQQYALAAAHQPHIGLA
PAAFVPNPYIISAAPPGTDPYTAGLAAAATLGPAVVPHQYYGVTPWGVYPASLFQQQAAAAAAATNSANQ
QTTPQAQQGQQQVLRGGASQRPLTPNQNQQGQQTDPLVAAAAVNSALAFGQGLAAGMPGYPVLAPAAYYD
QTGALVVNAGARNGLGAPVRLVAPAPVIISSSAAQAAVAAAAASANGAAGGLAGTTNGPFRPLGTQQPQP
QPQQQPNNNLASSSFYGNNSLNSNSQSSSLFSQGSAQPANTSLGFGSSSSLGATLGSALGGFGTAVANSN
TGSGSRRDSLTGSSDLYKRTSSSLTPIGHSFYNGLSFSSSPGPVGMPLPSQGPGHSQTPPPSLSSHGSSS
SLNLGGLTNGSGRYISAAPGAEAKYRSASSASSLFSPSSTLFSSSRLRYGMSDVMPSGRSRLLEDFRNNR
YPNLQLREIAGHIMEFSQDQHGSRFIQLKLERATPAERQLVFNEILQAAYQLMVDVFGNYVIQKFFEFGS
LEQKLALAERIRGHVLSLALQMYGCRVIQKALEFIPSDQQNEMVRELDGHVLKCVKDQNGNHVVQKCIEC
VQPQSLQFIIDAFKGQVFALSTHPYGCRVIQRILEHCLPDQTLPILEELHQHTEQLVQDQYGNYVIQHVL
EHGRPEDKSKIVAEIRGNVLVLSQHKFASNVVEKCVTHASRTERAVLIDEVCTMNDGPHSALYTMMKDQY
ANYVVQKMIDVAEPGQRKIVMHKIRPHIATLRKYTYGKHILAKLEKYYMKNGVDLGPICGPPNGII

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_014676
ORF Size 3558 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_014676.3
RefSeq Size 5410 bp
RefSeq ORF 3561 bp
Locus ID 9698
UniProt ID Q14671
Cytogenetics 1p35.2
Domains PUF
MW 126.5 kDa
Gene Summary This gene encodes a member of the PUF family, evolutionarily conserved RNA-binding proteins related to the Pumilio proteins of Drosophila and the fem-3 mRNA binding factor proteins of C. elegans. The encoded protein contains a sequence-specific RNA binding domain comprised of eight repeats and N- and C-terminal flanking regions, and serves as a translational regulator of specific mRNAs by binding to their 3' untranslated regions. The evolutionarily conserved function of the encoded protein in invertebrates and lower vertebrates suggests that the human protein may be involved in translational regulation of embryogenesis, and cell development and differentiation. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.