CCDC106 (NM_013301) Human Tagged ORF Clone

CAT#: RC201207

CCDC106 (Myc-DDK-tagged)-Human coiled-coil domain containing 106 (CCDC106)

Clone Modification / Custom Cloning Service

USD 98.00

USD 470.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name CCDC106 (NM_013301) Human Tagged ORF Clone
Symbol CCDC106
Synonyms HSU79303; ZNF581
Vector pCMV6-Entry
Sequence Data
>RC201207 representing NM_013301
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAATGACCGGAGCAGTCGGAGGCGGACAATGAAGGACGATGAGACCTTCGAGATCTCCATTCCCTTCG
ATGAGGCACCCCACCTAGACCCACAGATCTTTTACAGTCTGAGCCCCTCTCGGAGAAACTTCGAGGAGCC
TCCGGAGGCTGCGTCCTCCGCCCTGGCTCTGATGAACAGCGTCAAGACCCAGCTGCACATGGCTCTGGAG
AGGAACTCCTGGCTGCAGAAGCGCATCGAGGACCTGGAGGAAGAGAGGGACTTCCTGCGGTGCCAGCTGG
ACAAATTCATCTCTTCTGCTCGGATGGAGGCAGAGGACCACTGCCGGATGAAGCCTGGGCCCAGGCGGAT
GGAGGGGGACAGCCGTGGTGGGGCTGGGGGCGAGGCCTCGGACCCTGAGTCAGCAGCCTCCTCCCTCAGC
GGAGCGTCCGAAGAAGGCAGTGCCAGTGAGAGGAGGCGGCAGAAGCAGAAGGGAGGTGCTAGTCGGAGGC
GCTTTGGGAAGCCCAAGGCCCGGGAGAGGCAGCGAGTGAAGGACGCCGACGGGGTCCTCTGCCGGTACAA
GAAGATCCTGGGCACCTTCCAGAAGCTCAAGAGCATGTCGCGGGCCTTCGAGCACCACCGCGTGGACAGG
AACACCGTGGCGCTGACCACGCCCATCGCCGAGCTGCTCATTGTGGCCCCCGAGAAGCTGGCCGAGGTGG
GCGAGTTCGACCCCTCCAAGGAGCGCCTGCTCGAGTACTCCCGCCGCTGCTTTCTGGCCCTGGACGACGA
GACGCTCAAGAAGGTGCAGGCGCTCAAGAAGAGCAAGCTGCTGCTGCCCATCACCTACCGCTTCAAGCGG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC201207 representing NM_013301
Red=Cloning site Green=Tags(s)

MNDRSSRRRTMKDDETFEISIPFDEAPHLDPQIFYSLSPSRRNFEEPPEAASSALALMNSVKTQLHMALE
RNSWLQKRIEDLEEERDFLRCQLDKFISSARMEAEDHCRMKPGPRRMEGDSRGGAGGEASDPESAASSLS
GASEEGSASERRRQKQKGGASRRRFGKPKARERQRVKDADGVLCRYKKILGTFQKLKSMSRAFEHHRVDR
NTVALTTPIAELLIVAPEKLAEVGEFDPSKERLLEYSRRCFLALDDETLKKVQALKKSKLLLPITYRFKR

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_013301
ORF Size 840 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_013301.2, NP_037433
RefSeq Size 1993
RefSeq ORF 843
Locus ID 29903
Cytogenetics 19q13.42
MW 31.9 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)