KAP1 (TRIM28) (NM_005762) Human Tagged ORF Clone

CAT#: RC201205

Reviews ()
Write a review

TRIM28 (Myc-DDK-tagged)-Human tripartite motif containing 28 (TRIM28)



Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 477.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol TRIM28
Synonyms KAP1; PPP1R157; RNF96; TF1B; TIF1B
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC201205 representing NM_005762
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGCCTCCGCGGCGGCAGCCTCGGCAGCAGCGGCCTCGGCCGCCTCTGGCAGCCCGGGCCCGGGCG
AGGGCTCCGCTGGCGGCGAAAAGCGCTCCACCGCCCCTTCGGCCGCAGCCTCGGCCTCTGCCTCAGCCGC
GGCGTCGTCGCCCGCGGGGGGCGGCGCCGAGGCGCTGGAGCTGCTGGAGCACTGCGGCGTGTGCAGAGAG
CGCCTGCGACCCGAGAGGGAGCCCCGCCTGCTGCCCTGTTTGCACTCGGCCTGTAGTGCCTGCTTAGGGC
CCGCGGCCCCCGCCGCCGCCAACAGCTCGGGGGACGGCGGGGCGGCGGGCGACGGCACCGTGGTGGACTG
TCCCGTGTGCAAGCAACAGTGCTTCTCCAAAGACATCGTGGAGAATTATTTCATGCGTGATAGTGGCAGC
AAGGCTGCCACCGACGCCCAGGATGCGAACCAGTGCTGCACTAGCTGTGAGGATAATGCCCCAGCCACCA
GCTACTGTGTGGAGTGCTCGGAGCCTCTGTGTGAGACCTGTGTAGAGGCGCACCAGCGGGTGAAGTACAC
CAAGGACCATACTGTGCGCTCTACTGGGCCAGCCAAGTCTCGGGATGGTGAACGTACTGTCTATTGCAAC
GTACACAAGCATGAACCCCTTGTGCTGTTTTGTGAGAGCTGTGATACTCTCACCTGCCGAGACTGCCAGC
TCAATGCCCACAAGGACCACCAGTACCAGTTCTTAGAGGATGCAGTGAGGAACCAGCGCAAGCTCCTGGC
CTCACTGGTGAAGCGCCTTGGGGACAAACATGCAACATTGCAGAAGAGCACCAAGGAGGTTCGCAGCTCA
ATCCGCCAGGTGTCTGACGTACAGAAGCGTGTGCAAGTGGATGTCAAGATGGCCATCCTGCAGATCATGA
AGGAGCTGAATAAGCGGGGCCGTGTGCTGGTCAATGATGCCCAGAAGGTGACTGAGGGGCAGCAGGAGCG
CCTGGAGCGGCAGCACTGGACCATGACCAAGATCCAGAAGCACCAGGAGCACATTCTGCGCTTTGCCTCT
TGGGCTCTGGAGAGTGACAACAACACAGCCCTTTTGCTTTCTAAGAAGTTGATCTACTTCCAGCTGCACC
GGGCCCTCAAGATGATTGTGGATCCCGTGGAGCCACATGGCGAGATGAAGTTTCAGTGGGACCTCAATGC
CTGGACCAAGAGTGCCGAGGCCTTTGGCAAGATTGTGGCAGAGCGTCCTGGCACTAACTCAACAGGCCCT
GCACCCATGGCCCCTCCAAGAGCCCCAGGGCCCCTGAGCAAGCAGGGCTCTGGCAGCAGCCAGCCCATGG
AGGTGCAGGAAGGCTATGGCTTTGGGTCAGGAGATGATCCCTACTCAAGTGCAGAGCCCCATGTGTCAGG
TGTGAAACGGTCCCGCTCAGGTGAGGGCGAGGTGAGCGGCCTTATGCGCAAGGTGCCACGAGTGAGCCTT
GAACGCCTGGACCTGGACCTCACAGCTGACAGCCAGCCACCCGTCTTCAAGGTCTTCCCAGGCAGTACCA
CTGAGGACTACAACCTTATTGTTATTGAACGTGGCGCTGCCGCTGCAGCTACCGGCCAGCCAGGGACTGC
GCCTGCAGGAACCCCTGGTGCCCCACCCCTGGCTGGCATGGCCATTGTCAAGGAGGAGGAGACGGAGGCT
GCCATTGGAGCCCCTCCTACTGCCACTGAGGGCCCTGAGACCAAACCTGTGCTTATGGCTCTTGCGGAGG
GTCCTGGTGCTGAGGGTCCCCGCCTGGCCTCACCTAGTGGCAGCACCAGCTCAGGGCTGGAGGTGGTGGC
TCCTGAGGGTACCTCAGCCCCAGGTGGTGGCCCGGGAACCCTGGATGACAGTGCCACCATTTGCCGTGTC
TGCCAGAAGCCAGGCGATCTGGTTATGTGCAACCAGTGTGAGTTTTGTTTCCACCTGGACTGTCACCTGC
CGGCCCTGCAGGATGTACCAGGGGAGGAGTGGAGCTGCTCACTCTGCCATGTGCTCCCTGACCTGAAGGA
GGAGGATGGCAGCCTCAGCCTGGATGGTGCAGACAGCACTGGCGTGGTGGCCAAGCTCTCACCAGCCAAC
CAGCGGAAATGTGAGCGTGTACTGCTGGCCCTATTCTGTCACGAACCCTGCCGCCCCCTGCATCAGCTGG
CTACCGACTCCACCTTCTCCCTGGACCAGCCCGGTGGCACCCTGGATCTGACCCTGATCCGTGCCCGCCT
CCAGGAGAAGTTGTCACCTCCCTACAGCTCCCCACAGGAGTTTGCCCAGGATGTGGGCCGCATGTTCAAG
CAATTCAACAAGTTAACTGAGGACAAGGCAGACGTGCAGTCCATCATCGGCCTGCAGCGCTTCTTCGAGA
CGCGCATGAACGAGGCCTTCGGTGACACCAAGTTCTCTGCTGTGCTGGTGGAGCCCCCGCCGATGAGCCT
GCCTGGTGCTGGCCTGAGTTCCCAGGAGCTGTCTGGTGGCCCTGGTGATGGCCCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC201205 representing NM_005762
Red=Cloning site Green=Tags(s)

MAASAAAASAAAASAASGSPGPGEGSAGGEKRSTAPSAAASASASAAASSPAGGGAEALELLEHCGVCRE
RLRPEREPRLLPCLHSACSACLGPAAPAAANSSGDGGAAGDGTVVDCPVCKQQCFSKDIVENYFMRDSGS
KAATDAQDANQCCTSCEDNAPATSYCVECSEPLCETCVEAHQRVKYTKDHTVRSTGPAKSRDGERTVYCN
VHKHEPLVLFCESCDTLTCRDCQLNAHKDHQYQFLEDAVRNQRKLLASLVKRLGDKHATLQKSTKEVRSS
IRQVSDVQKRVQVDVKMAILQIMKELNKRGRVLVNDAQKVTEGQQERLERQHWTMTKIQKHQEHILRFAS
WALESDNNTALLLSKKLIYFQLHRALKMIVDPVEPHGEMKFQWDLNAWTKSAEAFGKIVAERPGTNSTGP
APMAPPRAPGPLSKQGSGSSQPMEVQEGYGFGSGDDPYSSAEPHVSGVKRSRSGEGEVSGLMRKVPRVSL
ERLDLDLTADSQPPVFKVFPGSTTEDYNLIVIERGAAAAATGQPGTAPAGTPGAPPLAGMAIVKEEETEA
AIGAPPTATEGPETKPVLMALAEGPGAEGPRLASPSGSTSSGLEVVAPEGTSAPGGGPGTLDDSATICRV
CQKPGDLVMCNQCEFCFHLDCHLPALQDVPGEEWSCSLCHVLPDLKEEDGSLSLDGADSTGVVAKLSPAN
QRKCERVLLALFCHEPCRPLHQLATDSTFSLDQPGGTLDLTLIRARLQEKLSPPYSSPQEFAQDVGRMFK
QFNKLTEDKADVQSIIGLQRFFETRMNEAFGDTKFSAVLVEPPPMSLPGAGLSSQELSGGPGDGP

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_005762
ORF Size 2505 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_005762.3
RefSeq Size 2989 bp
RefSeq ORF 2508 bp
Locus ID 10155
UniProt ID Q13263
Cytogenetics 19q13.43
Domains zf-B_box, BROMO, RING, PHD, BBC
Protein Families Protein Kinase, Stem cell - Pluripotency, Transcription Factors
MW 88.4 kDa
Gene Summary The protein encoded by this gene mediates transcriptional control by interaction with the Kruppel-associated box repression domain found in many transcription factors. The protein localizes to the nucleus and is thought to associate with specific chromatin regions. The protein is a member of the tripartite motif family. This tripartite motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. [provided by RefSeq, Jul 2008]
Other products for "TRIM28"
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.