CDC42EP4 (NM_012121) Human Tagged ORF Clone

CAT#: RC201162

CDC42EP4 (Myc-DDK-tagged)-Human CDC42 effector protein (Rho GTPase binding) 4 (CDC42EP4)

Change vector?

USD 577


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name CDC42EP4 (NM_012121) Human Tagged ORF Clone
Symbol CDC42EP4
Synonyms BORG4; CEP4; KAIA1777
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC201162 representing NM_012121
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCAATCCTCAAGCAACTGGTGTCCAGCTCGGTGCACTCCAAGCGCCGTTCCCGAGCGGACCTCACGG
CCGAGATGATCAGCGCCCCGCTGGGCGACTTCCGCCACACCATGCACGTTGGCCGGGCCGGAGACGCCTT
TGGGGACACCTCCTTCCTCAATAGCAAGGCTGGCGAGCCCGACGGCGAGTCCTTGGACGAACAGCCCTCT
TCTTCATCTTCCAAACGCAGTCTCCTGTCCAGGAAGTTCCGGGGCAGCAAGCGGTCACAGTCGGTGACCA
GGGGGGAGCGGGAGCAGCGTGACATGCTGGGCTCCCTGCGGGACTCGGCCCTGTTTGTCAAGAATGCCAT
GTCCCTGCCCCAGCTCAATGAGAAGGAGGCCGCGGAGAAGGGCACCAGTAAGCTGCCCAAGAGCCTGTCA
TCCAGCCCCGTGAAGAAGGCCAATGACGGGGAGGGCGGCGATGAGGAGGCGGGCACGGAGGAGGCAGTGC
CCCGTCGGAATGGGGCCGCGGGTCCACATTCCCCTGACCCCCTCCTCGATGAGCAGGCCTTTGGGGATCT
GACAGATCTGCCTGTCGTGCCCAAGGCCACGTACGGGCTGAAGCATGCGGAGTCCATCATGTCCTTCCAC
ATCGACCTGGGGCCCTCCATGCTGGGTGACGTCCTCAGCATCATGGACAAGGAGGAGTGGGACCCCGAGG
AGGGGGAGGGTGGTTACCATGGCGATGAGGGCGCCGCTGGCACCATCACCCAGGCTCCCCCGTACGCCGT
GGCGGCCCCTCCCCTGGCAAGGCAGGAAGGCAAGGCTGGCCCAGACTTGCCCTCCCTCCCCTCCCATGCT
CTGGAGGATGAGGGGTGGGCAGCAGCGGCCCCCAGCCCCGGCTCAGCCCGCAGCATGGGCAGCCACACCA
CACGGGACAGCAGCTCCCTCTCCAGCTGCACCTCAGGCATCCTGGAGGAGCGCAGCCCTGCCTTCCGGGG
GCCGGACAGGGCCCGGGCTGCTGTCTCAAGACAGCCAGACAAGGAGTTCTCCTTCATGGATGAGGAGGAG
GAGGATGAAATCCGTGTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC201162 representing NM_012121
Red=Cloning site Green=Tags(s)

MPILKQLVSSSVHSKRRSRADLTAEMISAPLGDFRHTMHVGRAGDAFGDTSFLNSKAGEPDGESLDEQPS
SSSSKRSLLSRKFRGSKRSQSVTRGEREQRDMLGSLRDSALFVKNAMSLPQLNEKEAAEKGTSKLPKSLS
SSPVKKANDGEGGDEEAGTEEAVPRRNGAAGPHSPDPLLDEQAFGDLTDLPVVPKATYGLKHAESIMSFH
IDLGPSMLGDVLSIMDKEEWDPEEGEGGYHGDEGAAGTITQAPPYAVAAPPLARQEGKAGPDLPSLPSHA
LEDEGWAAAAPSPGSARSMGSHTTRDSSSLSSCTSGILEERSPAFRGPDRARAAVSRQPDKEFSFMDEEE
EDEIRV

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_012121
ORF Size 1068 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_012121.1, NM_012121.2, NM_012121.3, NM_012121.4, NP_036253
RefSeq Size 3121
RefSeq ORF 1071
Locus ID 23580
Cytogenetics 17q25.1
Domains PBD
MW 37.8 kDa
Gene Summary The product of this gene is a member of the CDC42-binding protein family. Members of this family interact with Rho family GTPases and regulate the organization of the actin cytoskeleton. This protein has been shown to bind both CDC42 and TC10 GTPases in a GTP-dependent manner. When overexpressed in fibroblasts, this protein was able to induce pseudopodia formation, which suggested a role in inducing actin filament assembly and cell shape control. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations