Integrin alpha 5 (ITGA5) (NM_002205) Human Tagged ORF Clone

CAT#: RC201151

Reviews ()
Write a review

ITGA5 (Myc-DDK-tagged)-Human integrin, alpha 5 (fibronectin receptor, alpha polypeptide) (ITGA5)



Reconstitution Protocol

USD 913.00

USD 1,369.00

In Stock*

Size
    • 10 ug

Product images

Other products for "ITGA5"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol ITGA5
Synonyms CD49e; FNRA; VLA-5; VLA5A
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC201151 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGAGCCGGACGCCAGAGTCCCCTCTCCACGCCGTGCAGCTGCGCTGGGGCCCCCGGCGCCGACCCC
CGCTGCTGCCGCTGCTGTTGCTGCTGCTGCCGCCGCCACCCAGGGTCGGGGGCTTCAACTTAGACGCGGA
GGCCCCAGCAGTACTCTCGGGGCCCCCGGGCTCCTTCTTCGGATTCTCAGTGGAGTTTTACCGGCCGGGA
ACAGACGGGGTCAGTGTGCTGGTGGGAGCACCCAAGGCTAATACCAGCCAGCCAGGAGTGCTGCAGGGTG
GTGCTGTCTACCTCTGTCCTTGGGGTGCCAGCCCCACACAGTGCACCCCCATTGAATTTGACAGCAAAGG
CTCTCGGCTCCTGGAGTCCTCACTGTCCAGCTCAGAGGGAGAGGAGCCTGTGGAGTACAAGTCCTTGCAG
TGGTTCGGGGCAACAGTTCGAGCCCATGGCTCCTCCATCTTGGCATGCGCTCCACTGTACAGCTGGCGCA
CAGAGAAGGAGCCACTGAGCGACCCCGTGGGCACCTGCTACCTCTCCACAGATAACTTCACCCGAATTCT
GGAGTATGCACCCTGCCGCTCAGATTTCAGCTGGGCAGCAGGACAGGGTTACTGCCAAGGAGGCTTCAGT
GCCGAGTTCACCAAGACTGGCCGTGTGGTTTTAGGTGGACCAGGAAGCTATTTCTGGCAAGGCCAGATCC
TGTCTGCCACTCAGGAGCAGATTGCAGAATCTTATTACCCCGAGTACCTGATCAACCTGGTTCAGGGGCA
GCTGCAGACTCGCCAGGCCAGTTCCATCTATGATGACAGCTACCTAGGATACTCTGTGGCTGTTGGTGAA
TTCAGTGGTGATGACACAGAAGACTTTGTTGCTGGTGTGCCCAAAGGGAACCTCACTTACGGCTATGTCA
CCATCCTTAATGGCTCAGACATTCGATCCCTCTACAACTTCTCAGGGGAACAGATGGCCTCCTACTTTGG
CTATGCAGTGGCCGCCACAGACGTCAATGGGGACGGGCTGGATGACTTGCTGGTGGGGGCACCCCTGCTC
ATGGATCGGACCCCTGACGGGCGGCCTCAGGAGGTGGGCAGGGTCTACGTCTACCTGCAGCACCCAGCCG
GCATAGAGCCCACGCCCACCCTTACCCTCACTGGCCATGATGAGTTTGGCCGATTTGGCAGCTCCTTGAC
CCCCCTGGGGGACCTGGACCAGGATGGCTACAATGATGTGGCCATCGGGGCTCCCTTTGGTGGGGAGACC
CAGCAGGGAGTAGTGTTTGTATTTCCTGGGGGCCCAGGAGGGCTGGGCTCTAAGCCTTCCCAGGTTCTGC
AGCCCCTGTGGGCAGCCAGCCACACCCCAGACTTCTTTGGCTCTGCCCTTCGAGGAGGCCGAGACCTGGA
TGGCAATGGATATCCTGATCTGATTGTGGGGTCCTTTGGTGTGGACAAGGCTGTGGTATACAGGGGCCGC
CCCATCGTGTCCGCTAGTGCCTCCCTCACCATCTTCCCCGCCATGTTCAACCCAGAGGAGCGGAGCTGCA
GCTTAGAGGGGAACCCTGTGGCCTGCATCAACCTTAGCTTCTGCCTCAATGCTTCTGGAAAACACGTTGC
TGACTCCATTGGTTTCACAGTGGAACTTCAGCTGGACTGGCAGAAGCAGAAGGGAGGGGTACGGCGGGCA
CTGTTCCTGGCCTCCAGGCAGGCAACCCTGACCCAGACCCTGCTCATCCAGAATGGGGCTCGAGAGGATT
GCAGAGAGATGAAGATCTACCTCAGGAACGAGTCAGAATTTCGAGACAAACTCTCGCCGATTCACATCGC
TCTCAACTTCTCCTTGGACCCCCAAGCCCCAGTGGACAGCCACGGCCTCAGGCCAGCCCTACATTATCAG
AGCAAGAGCCGGATAGAGGACAAGGCTCAGATCTTGCTGGACTGTGGAGAAGACAACATCTGTGTGCCTG
ACCTGCAGCTGGAAGTGTTTGGGGAGCAGAACCATGTGTACCTGGGTGACAAGAATGCCCTGAACCTCAC
TTTCCATGCCCAGAATGTGGGTGAGGGTGGCGCCTATGAGGCTGAGCTTCGGGTCACCGCCCCTCCAGAG
GCTGAGTACTCAGGACTCGTCAGACACCCAGGGAACTTCTCCAGCCTGAGCTGTGACTACTTTGCCGTGA
ACCAGAGCCGCCTGCTGGTGTGTGACCTGGGCAACCCCATGAAGGCAGGAGCCAGTCTGTGGGGTGGCCT
TCGGTTTACAGTCCCTCATCTCCGGGACACTAAGAAAACCATCCAGTTTGACTTCCAGATCCTCAGCAAG
AATCTCAACAACTCGCAAAGCGACGTGGTTTCCTTTCGGCTCTCCGTGGAGGCTCAGGCCCAGGTCACCC
TGAACGGTGTCTCCAAGCCTGAGGCAGTGCTATTCCCAGTAAGCGACTGGCATCCCCGAGACCAGCCTCA
GAAGGAGGAGGACCTGGGACCTGCTGTCCACCATGTCTATGAGCTCATCAACCAAGGCCCCAGCTCCATT
AGCCAGGGTGTGCTGGAACTCAGCTGTCCCCAGGCTCTGGAAGGTCAGCAGCTCCTATATGTGACCAGAG
TTACGGGACTCAACTGCACCACCAATCACCCCATTAACCCAAAGGGCCTGGAGTTGGATCCCGAGGGTTC
CCTGCACCACCAGCAAAAACGGGAAGCTCCAAGCCGCAGCTCTGCTTCCTCGGGACCTCAGATCCTGAAA
TGCCCGGAGGCTGAGTGTTTCAGGCTGCGCTGTGAGCTCGGGCCCCTGCACCAACAAGAGAGCCAAAGTC
TGCAGTTGCATTTCCGAGTCTGGGCCAAGACTTTCTTGCAGCGGGAGCACCAGCCATTTAGCCTGCAGTG
TGAGGCTGTGTACAAAGCCCTGAAGATGCCCTACCGAATCCTGCCTCGGCAGCTGCCCCAAAAAGAGCGT
CAGGTGGCCACAGCTGTGCAATGGACCAAGGCAGAAGGCAGCTATGGCGTCCCACTGTGGATCATCATCC
TAGCCATCCTGTTTGGCCTCCTGCTCCTAGGTCTACTCATCTACATCCTCTACAAGCTTGGATTCTTCAA
ACGCTCCCTCCCATATGGCACCGCCATGGAAAAAGCTCAGCTCAAGCCTCCAGCCACCTCTGATGCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC201151 protein sequence
Red=Cloning site Green=Tags(s)

MGSRTPESPLHAVQLRWGPRRRPPLLPLLLLLLPPPPRVGGFNLDAEAPAVLSGPPGSFFGFSVEFYRPG
TDGVSVLVGAPKANTSQPGVLQGGAVYLCPWGASPTQCTPIEFDSKGSRLLESSLSSSEGEEPVEYKSLQ
WFGATVRAHGSSILACAPLYSWRTEKEPLSDPVGTCYLSTDNFTRILEYAPCRSDFSWAAGQGYCQGGFS
AEFTKTGRVVLGGPGSYFWQGQILSATQEQIAESYYPEYLINLVQGQLQTRQASSIYDDSYLGYSVAVGE
FSGDDTEDFVAGVPKGNLTYGYVTILNGSDIRSLYNFSGEQMASYFGYAVAATDVNGDGLDDLLVGAPLL
MDRTPDGRPQEVGRVYVYLQHPAGIEPTPTLTLTGHDEFGRFGSSLTPLGDLDQDGYNDVAIGAPFGGET
QQGVVFVFPGGPGGLGSKPSQVLQPLWAASHTPDFFGSALRGGRDLDGNGYPDLIVGSFGVDKAVVYRGR
PIVSASASLTIFPAMFNPEERSCSLEGNPVACINLSFCLNASGKHVADSIGFTVELQLDWQKQKGGVRRA
LFLASRQATLTQTLLIQNGAREDCREMKIYLRNESEFRDKLSPIHIALNFSLDPQAPVDSHGLRPALHYQ
SKSRIEDKAQILLDCGEDNICVPDLQLEVFGEQNHVYLGDKNALNLTFHAQNVGEGGAYEAELRVTAPPE
AEYSGLVRHPGNFSSLSCDYFAVNQSRLLVCDLGNPMKAGASLWGGLRFTVPHLRDTKKTIQFDFQILSK
NLNNSQSDVVSFRLSVEAQAQVTLNGVSKPEAVLFPVSDWHPRDQPQKEEDLGPAVHHVYELINQGPSSI
SQGVLELSCPQALEGQQLLYVTRVTGLNCTTNHPINPKGLELDPEGSLHHQQKREAPSRSSASSGPQILK
CPEAECFRLRCELGPLHQQESQSLQLHFRVWAKTFLQREHQPFSLQCEAVYKALKMPYRILPRQLPQKER
QVATAVQWTKAEGSYGVPLWIIILAILFGLLLLGLLIYILYKLGFFKRSLPYGTAMEKAQLKPPATSDA

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_002205
ORF Size 3147 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_002205.5
RefSeq Size 4267 bp
RefSeq ORF 3150 bp
Locus ID 3678
UniProt ID P08648
Cytogenetics 12q13.13
Domains FG-GAP
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Transmembrane
Protein Pathways Arrhythmogenic right ventricular cardiomyopathy (ARVC), Dilated cardiomyopathy, ECM-receptor interaction, Focal adhesion, Hematopoietic cell lineage, Hypertrophic cardiomyopathy (HCM), Regulation of actin cytoskeleton
MW 114.5 kDa
Gene Summary The product of this gene belongs to the integrin alpha chain family. Integrins are heterodimeric integral membrane proteins composed of an alpha subunit and a beta subunit that function in cell surface adhesion and signaling. The encoded preproprotein is proteolytically processed to generate light and heavy chains that comprise the alpha 5 subunit. This subunit associates with the beta 1 subunit to form a fibronectin receptor. This integrin may promote tumor invasion, and higher expression of this gene may be correlated with shorter survival time in lung cancer patients. Note that the integrin alpha 5 and integrin alpha V subunits are encoded by distinct genes. [provided by RefSeq, Oct 2015]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.