MNK1(MKNK1) (NM_003684) Human Tagged ORF Clone

CAT#: RC201149

MKNK1 (Myc-DDK-tagged)-Human MAP kinase interacting serine/threonine kinase 1 (MKNK1), transcript variant 1

Change vector?

USD 577


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name MNK1(MKNK1) (NM_003684) Human Tagged ORF Clone
Symbol MKNK1
Synonyms MNK1; MNK1
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC201149 representing NM_003684
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTATCTTCTCAAAAGTTGGAAAAACCTATAGAGATGGGCAGTAGCGAACCCCTTCCCATCGCAGATG
GTGACAGGAGGAGGAAGAAGAAGCGGAGGGGCCGGGCCACTGACTCCTTGCCAGGAAAGTTTGAAGATAT
GTACAAGCTGACCTCTGAATTGCTTGGAGAGGGAGCCTATGCCAAAGTTCAAGGTGCCGTGAGCCTACAG
AATGGCAAAGAGTATGCCGTCAAAATCATCGAGAAACAAGCAGGGCACAGTCGGAGTAGGGTGTTTCGAG
AGGTGGAGACGCTGTATCAGTGTCAGGGAAACAAGAACATTTTGGAGCTGATTGAGTTCTTTGAAGATGA
CACAAGGTTTTACTTGGTCTTTGAGAAATTGCAAGGAGGTTCCATCTTAGCCCACATCCAGAAGCAAAAG
CACTTCAATGAGCGAGAAGCCAGCCGAGTGGTGCGGGACGTTGCTGCTGCCCTTGACTTCCTGCATACCA
AAGACAAAGTCTCTCTCTGTCACCTAGGCTGGAGTGCTATGGCGCCATCAGGGCTCACTGCAGCCCCAAC
CTCCCTGGGCTCCAGTGATCCTCCCACCTCAGCCTCCCAAGTAGCTGGGACTACAGGCATTGCTCATCGT
GATCTGAAACCAGAAAATATATTGTGTGAATCTCCAGAAAAGGTGTCTCCAGTGAAAATCTGTGACTTTG
ACTTGGGCAGTGGGATGAAACTGAACAACTCCTGTACCCCCATAACCACACCAGAGCTGACCACCCCATG
TGGCTCTGCAGAATACATGGCCCCTGAGGTAGTGGAGGTCTTCACGGACCAGGCCACATTCTACGACAAG
CGCTGTGACCTGTGGAGCCTGGGCGTGGTCCTCTACATCATGCTGAGTGGCTACCCACCCTTCGTGGGTC
ACTGCGGGGCCGACTGTGGCTGGGACCGGGGCGAGGTCTGCAGGGTGTGCCAGAACAAGCTGTTTGAAAG
CATCCAGGAAGGCAAGTATGAGTTTCCTGACAAGGACTGGGCACACATCTCCAGTGAAGCCAAAGACCTC
ATCTCCAAGCTCCTGGTGCGAGATGCAAAGCAGAGACTTAGCGCCGCCCAAGTTCTGCAGCACCCATGGG
TGCAGGGGCAAGCTCCAGAAAAGGGACTCCCCACGCCGCAAGTCCTCCAGAGGAACAGCAGCACAATGGA
CCTGACGCTCTTCGCAGCTGAGGCCATCGCCCTTAACCGCCAGCTATCTCAGCACGAAGAGAACGAACTA
GCAGAGGAGCCAGAGGCACTAGCTGATGGCCTCTGCTCCATGAAGCTTTCCCCTCCCTGCAAGTCACGCC
TGGCCCGGAGACGGGCCCTGGCCCAGGCAGGCCGTGGTGAAGACAGGAGCCCGCCCACAGCACTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC201149 representing NM_003684
Red=Cloning site Green=Tags(s)

MVSSQKLEKPIEMGSSEPLPIADGDRRRKKKRRGRATDSLPGKFEDMYKLTSELLGEGAYAKVQGAVSLQ
NGKEYAVKIIEKQAGHSRSRVFREVETLYQCQGNKNILELIEFFEDDTRFYLVFEKLQGGSILAHIQKQK
HFNEREASRVVRDVAAALDFLHTKDKVSLCHLGWSAMAPSGLTAAPTSLGSSDPPTSASQVAGTTGIAHR
DLKPENILCESPEKVSPVKICDFDLGSGMKLNNSCTPITTPELTTPCGSAEYMAPEVVEVFTDQATFYDK
RCDLWSLGVVLYIMLSGYPPFVGHCGADCGWDRGEVCRVCQNKLFESIQEGKYEFPDKDWAHISSEAKDL
ISKLLVRDAKQRLSAAQVLQHPWVQGQAPEKGLPTPQVLQRNSSTMDLTLFAAEAIALNRQLSQHEENEL
AEEPEALADGLCSMKLSPPCKSRLARRRALAQAGRGEDRSPPTAL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_003684
ORF Size 1395 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_003684.2, NM_003684.3, NM_003684.4, NM_003684.5, NP_003675
RefSeq Size 2736
RefSeq ORF 1398
Locus ID 8569
Cytogenetics 1p33
Domains pkinase, TyrKc, S_TKc
Protein Families Protein Kinase, Druggable Genome
Protein Pathways MAPK signaling pathway, Insulin signaling pathway
MW 51.2 kDa
Gene Summary This gene encodes a Ser/Thr protein kinase that interacts with, and is activated by ERK1 and p38 mitogen-activated protein kinases, and thus may play a role in the response to environmental stress and cytokines. This kinase may also regulate transcription by phosphorylating eIF4E via interaction with the C-terminal region of eIF4G. Alternatively spliced transcript variants have been noted for this gene. [provided by RefSeq, Jan 2012].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.