PROX1 (NM_002763) Human Tagged ORF Clone

CAT#: RC201140

Reviews ()
Write a review

PROX1 (Myc-DDK-tagged)-Human prospero homeobox 1 (PROX1)



  "NM_002763" in other vectors (6)

Reconstitution Protocol

USD 1,013.00

In Stock*

Size
    • 10 ug

Product images

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "PROX1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol PROX1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC201140 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCTGACCATGACAGCACAGCCCTCTTAAGCCGGCAAACCAAGAGGAGAAGAGTTGACATTGGAGTGA
AAAGGACGGTAGGGACAGCATCTGCATTTTTTGCTAAGGCAAGAGCAACGTTTTTTAGTGCCATGAATCC
CCAAGGTTCTGAGCAGGATGTTGAGTATTCAGTGGTGCAGCATGCAGATGGGGAAAAGTCAAATGTACTC
CGCAAGCTGCTGAAGAGGGCGAACTCGTATGAAGATGCCATGATGCCTTTTCCAGGAGCAACCATAATTT
CCCAGCTGTTGAAAAATAACATGAACAAAAATGGTGGCACGGAGCCCAGTTTCCAAGCCAGCGGTCTCTC
TAGTACAGGCTCCGAAGTACATCAGGAGGATATATGCAGCAACTCTTCAAGAGACAGCCCCCCAGAGTGT
CTTTCCCCTTTTGGCAGGCCTACTATGAGCCAGTTTGATATGGATCGCTTATGTGATGAGCACCTGAGAG
CAAAGCGCGCCCGGGTTGAGAATATAATTCGGGGTATGAGCCATTCCCCCAGTGTGGCATTAAGGGGCAA
TGAAAATGAAAGAGAGATGGCCCCGCAGTCTGTGAGTCCCCGAGAAAGTTACAGAGAAAACAAACGCAAG
CAAAAGCTTCCCCAGCAGCAGCAACAGAGTTTCCAGCAGCTGGTTTCAGCCCGAAAAGAACAGAAGCGAG
AGGAGCGCCGACAGCTGAAACAGCAGCTGGAGGACATGCAGAAACAGCTGCGCCAGCTGCAGGAAAAGTT
CTACCAAATCTATGACAGCACTGATTCGGAAAATGATGAAGATGGTAACCTGTCTGAAGACAGCATGCGC
TCGGAGATCCTGGATGCCAGGGCCCAGGACTCTGTCGGAAGGTCAGATAATGAGATGTGCGAGCTAGACC
CAGGACAGTTTATTGACCGAGCTCGAGCCCTGATCAGAGAGCAGGAAATGGCTGAAAACAAGCCGAAGCG
AGAAGGCAACAACAAAGAAAGAGACCATGGGCCAAACTCCTTACAACCGGAAGGCAAACATTTGGCTGAG
ACCTTGAAACAGGAACTGAACACTGCCATGTCGCAAGTTGTGGACACTGTGGTCAAAGTCTTTTCGGCCA
AGCCCTCCCGCCAGGTTCCTCAGGTCTTCCCACCTCTCCAGATCCCCCAGGCCAGATTTGCAGTCAATGG
GGAAAACCACAATTTCCACACCGCCAACCAGCGCCTGCAGTGCTTTGGCGACGTCATCATTCCGAACCCC
CTGGACACCTTTGGCAATGTGCAGATGGCCAGTTCCACTGACCAGACAGAAGCACTGCCCCTGGTTGTCC
GCAAAAACTCCTCTGACCAGTCTGCCTCCGGCCCTGCCGCTGGCGGCCACCACCAGCCCCTGCACCAGTC
GCCTCTCTCTGCCACCACGGGCTTCACCACGTCCACCTTCCGCCACCCCTTCCCCCTTCCCTTGATGGCC
TATCCATTTCAGAGCCCATTAGGTGCTCCCTCCGGCTCCTTCTCTGGAAAAGACAGAGCCTCTCCTGAAT
CCTTAGACTTAACTAGGGATACCACGAGTCTGAGGACCAAGATGTCATCTCACCACCTGAGCCACCACCC
TTGTTCACCAGCACACCCGCCCAGCACCGCCGAAGGGCTCTCCTTGTCGCTCATAAAGTCCGAGTGCGGC
GATCTTCAAGATATGTCTGAAATATCACCTTATTCGGGAAGTGCAATGCAGGAAGGATTGTCACCCAATC
ACTTGAAAAAAGCAAAGCTCATGTTTTTTTATACCCGTTATCCCAGCTCCAATATGCTGAAGACCTACTT
CTCCGACGTAAAGTTCAACAGATGCATTACCTCTCAGCTCATCAAGTGGTTTAGCAATTTCCGTGAGTTT
TACTACATTCAGATGGAGAAGTACGCACGTCAAGCCATCAACGATGGGGTCACCAGTACTGAAGAGCTGT
CTATAACCAGAGACTGTGAGCTGTACAGGGCTCTGAACATGCACTACAATAAAGCAAATGACTTTGAGGT
TCCAGAGAGATTCCTGGAAGTTGCTCAGATCACATTACGGGAGTTTTTCAATGCCATTATCGCAGGCAAA
GATGTTGATCCTTCCTGGAAGAAGGCCATATACAAGGTCATCTGCAAGCTGGATAGTGAAGTCCCTGAGA
TTTTCAAATCCCCGAACTGCCTACAAGAGCTGCTTCATGAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC201140 protein sequence
Red=Cloning site Green=Tags(s)

MPDHDSTALLSRQTKRRRVDIGVKRTVGTASAFFAKARATFFSAMNPQGSEQDVEYSVVQHADGEKSNVL
RKLLKRANSYEDAMMPFPGATIISQLLKNNMNKNGGTEPSFQASGLSSTGSEVHQEDICSNSSRDSPPEC
LSPFGRPTMSQFDMDRLCDEHLRAKRARVENIIRGMSHSPSVALRGNENEREMAPQSVSPRESYRENKRK
QKLPQQQQQSFQQLVSARKEQKREERRQLKQQLEDMQKQLRQLQEKFYQIYDSTDSENDEDGNLSEDSMR
SEILDARAQDSVGRSDNEMCELDPGQFIDRARALIREQEMAENKPKREGNNKERDHGPNSLQPEGKHLAE
TLKQELNTAMSQVVDTVVKVFSAKPSRQVPQVFPPLQIPQARFAVNGENHNFHTANQRLQCFGDVIIPNP
LDTFGNVQMASSTDQTEALPLVVRKNSSDQSASGPAAGGHHQPLHQSPLSATTGFTTSTFRHPFPLPLMA
YPFQSPLGAPSGSFSGKDRASPESLDLTRDTTSLRTKMSSHHLSHHPCSPAHPPSTAEGLSLSLIKSECG
DLQDMSEISPYSGSAMQEGLSPNHLKKAKLMFFYTRYPSSNMLKTYFSDVKFNRCITSQLIKWFSNFREF
YYIQMEKYARQAINDGVTSTEELSITRDCELYRALNMHYNKANDFEVPERFLEVAQITLREFFNAIIAGK
DVDPSWKKAIYKVICKLDSEVPEIFKSPNCLQELLHE

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_002763
ORF Size 2214 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_002763.5
RefSeq Size 8178 bp
RefSeq ORF 2214 bp
Locus ID 5629
UniProt ID Q92786
Cytogenetics 1q32.3
Domains Prox1
Protein Families Embryonic stem cells, ES Cell Differentiation/IPS
MW 83.2 kDa
Gene Summary The protein encoded by this gene is a member of the homeobox transcription factor family. Members of this family contain a homeobox domain that consists of a 60-amino acid helix-turn-helix structure that binds DNA and RNA. The protein encoded by this gene is conserved across vertebrates and may play an essential role during development. Altered levels of this protein have been reported in cancers of different organs, such as colon, brain, blood, breast, pancreas, liver and esophagus. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2012]

Other Versions

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.