Alpha Dystroglycan(DAG1) (NM_004393) Human Tagged ORF Clone

CAT#: RC201121

DAG1 (Myc-DDK-tagged)-Human dystroglycan 1 (dystrophin-associated glycoprotein 1) (DAG1), transcript variant 2

  • TrueORF®

Need custom modification / cloning service?
Get a free quote

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Cited in 2 publications.

Product images

Specifications

Product Data
Product Name Alpha Dystroglycan(DAG1) (NM_004393) Human Tagged ORF Clone
Symbol DAG1
Synonyms 156DAG; A3a; AGRNR; DAG; MDDGC7; MDDGC9
Vector pCMV6-Entry
Sequence Data
>RC201121 representing NM_004393
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGGATGTCTGTGGGCCTCTCGCTGCTGCTGCCCCTCTGGGGGAGGACCTTTCTCCTCCTGCTCTCTG
TGGTTATGGCTCAGTCCCACTGGCCCAGTGAACCCTCAGAGGCTGTCAGGGACTGGGAAAACCAGCTTGA
GGCATCCATGCACTCAGTGCTCTCAGACCTCCACGAGGCTGTTCCCACAGTGGTTGGCATTCCTGATGGC
ACGGCTGTCGTCGGGCGCTCATTTCGAGTGACCATTCCAACAGATTTGATTGCCTCCAGTGGAGATATCA
TCAAGGTATCAGCGGCAGGGAAGGAGGCTTTGCCATCTTGGCTGCACTGGGACTCACAGAGCCACACCCT
GGAGGGCCTCCCCCTTGACACTGATAAGGGTGTGCATTACATTTCAGTGAGCGCTACACGGCTGGGGGCC
AACGGGAGCCACATCCCCCAGACCTCCAGTGTGTTCTCCATCGAGGTCTACCCTGAAGACCACAGTGAGC
TGCAGTCGGTGAGGACAGCCTCCCCAGACCCTGGTGAGGTGGTATCATCTGCCTGTGCTGCGGATGAACC
TGTGACTGTTTTGACGGTGATTTTGGATGCCGACCTCACCAAGATGACCCCAAAGCAAAGGATTGACCTC
CTGCACAGGATGCGGAGCTTCTCAGAAGTAGAGCTTCACAACATGAAATTAGTGCCGGTGGTGAATAACA
GACTATTTGACATGTCGGCCTTCATGGCTGGCCCGGGAAATGCAAAAAAGGTGGTGGAGAATGGGGCCCT
TCTCTCCTGGAAGCTGGGCTGCTCCCTGAACCAGAACAGTGTGCCTGACATTCATGGTGTAGAGGCCCCT
GCCAGGGAGGGCGCAATGTCTGCTCAGCTTGGCTACCCTGTGGTGGGTTGGCACATCGCCAATAAGAAGC
CCCCTCTTCCCAAACGCGTCCGGAGGCAGATCCATGCTACACCCACACCTGTCACTGCCATTGGGCCCCC
AACCACGGCTATCCAGGAGCCCCCATCCAGGATCGTGCCAACCCCCACATCTCCAGCCATTGCTCCTCCA
ACAGAGACCATGGCTCCTCCAGTCAGGGATCCTGTTCCTGGGAAACCCACGGTCACCATCCGGACTCGAG
GCGCCATTATTCAAACCCCAACCCTAGGCCCCATCCAGCCTACTCGGGTGTCAGAAGCTGGCACCACAGT
TCCTGGCCAGATTCGCCCAACGATGACCATTCCTGGCTATGTGGAGCCTACTGCAGTTGCTACCCCTCCC
ACAACCACCACCAAGAAGCCACGAGTATCCACACCAAAACCAGCAACGCCTTCAACTGACTCCACCACCA
CCACGACTCGCAGGCCAACCAAGAAACCACGGACACCCCGGCCAGTGCCCCGGGTCACCACCAAAGTTTC
CATCACCAGATTGGAAACTGCCTCACCGCCTACTCGTATTCGCACCACCACCAGTGGAGTGCCCCGTGGC
GGAGAACCCAACCAGCGCCCAGAGCTCAAGAACCATATTGACAGGGTAGATGCCTGGGTTGGCACCTACT
TTGAGGTGAAGATCCCGTCAGACACTTTCTATGACCATGAGGACACCACCACTGACAAGCTGAAGCTGAC
CCTGAAACTGCGGGAGCAGCAGCTGGTGGGCGAGAAGTCCTGGGTACAGTTCAACAGCAACAGCCAGCTC
ATGTATGGCCTTCCCGACAGCAGCCACGTGGGCAAACACGAGTATTTCATGCATGCCACAGACAAGGGGG
GCCTGTCGGCTGTGGATGCCTTCGAGATCCACGTCCACAGGCGCCCCCAAGGGGATAGGGCTCCTGCAAG
GTTCAAGGCCAAGTTTGTGGGTGACCCGGCACTGGTGTTGAATGACATCCACAAGAAGATTGCCTTGGTA
AAGAAACTGGCCTTCGCCTTTGGAGACCGAAACTGTAGCACCATCACCCTGCAGAATATCACCCGGGGCT
CCATCGTGGTGGAATGGACCAACAACACACTGCCCTTGGAGCCCTGCCCCAAGGAGCAGATCGCTGGGCT
GAGCCGCCGGATCGCTGAGGATGATGGAAAACCTCGGCCTGCCTTCTCCAACGCCCTAGAGCCTGACTTT
AAGGCCACAAGCATCACTGTGACGGGCTCTGGCAGTTGTCGGCACCTACAGTTTATCCCTGTGGTACCAC
CCAGGAGAGTGCCCTCAGAGGCGCCGCCCACAGAAGTGCCTGACAGGGACCCTGAGAAGAGCAGTGAGGA
TGATGTCTACCTGCATACAGTCATTCCGGCCGTGGTGGTCGCAGCCATCCTGCTCATTGCTGGCATCATT
GCCATGATCTGCTACCGCAAGAAGCGGAAGGGCAAGCTTACCCTTGAGGACCAGGCCACCTTCATCAAGA
AGGGGGTGCCTATCATCTTTGCAGACGAACTGGACGACTCCAAGCCCCCACCCTCCTCCAGCATGCCACT
CATTCTGCAGGAGGAGAAGGCTCCCCTACCCCCTCCTGAGTACCCCAACCAGAGTGTGCCCGAGACCACT
CCTCTGAACCAGGACACCATGGGAGAGTACACGCCCCTGCGGGATGAGGATCCCAATGCGCCTCCCTACC
AGCCCCCACCGCCCTTCACAGCACCCATGGAGGGCAAGGGCTCCCGTCCCAAGAACATGACCCCATACCG
GTCACCTCCTCCCTATGTCCCACCT


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAG
GTTTAA
>RC201121 representing NM_004393
Red=Cloning site Green=Tags(s)

MRMSVGLSLLLPLWGRTFLLLLSVVMAQSHWPSEPSEAVRDWENQLEASMHSVLSDLHEAVPTVVGIPDG
TAVVGRSFRVTIPTDLIASSGDIIKVSAAGKEALPSWLHWDSQSHTLEGLPLDTDKGVHYISVSATRLGA
NGSHIPQTSSVFSIEVYPEDHSELQSVRTASPDPGEVVSSACAADEPVTVLTVILDADLTKMTPKQRIDL
LHRMRSFSEVELHNMKLVPVVNNRLFDMSAFMAGPGNAKKVVENGALLSWKLGCSLNQNSVPDIHGVEAP
AREGAMSAQLGYPVVGWHIANKKPPLPKRVRRQIHATPTPVTAIGPPTTAIQEPPSRIVPTPTSPAIAPP
TETMAPPVRDPVPGKPTVTIRTRGAIIQTPTLGPIQPTRVSEAGTTVPGQIRPTMTIPGYVEPTAVATPP
TTTTKKPRVSTPKPATPSTDSTTTTTRRPTKKPRTPRPVPRVTTKVSITRLETASPPTRIRTTTSGVPRG
GEPNQRPELKNHIDRVDAWVGTYFEVKIPSDTFYDHEDTTTDKLKLTLKLREQQLVGEKSWVQFNSNSQL
MYGLPDSSHVGKHEYFMHATDKGGLSAVDAFEIHVHRRPQGDRAPARFKAKFVGDPALVLNDIHKKIALV
KKLAFAFGDRNCSTITLQNITRGSIVVEWTNNTLPLEPCPKEQIAGLSRRIAEDDGKPRPAFSNALEPDF
KATSITVTGSGSCRHLQFIPVVPPRRVPSEAPPTEVPDRDPEKSSEDDVYLHTVIPAVVVAAILLIAGII
AMICYRKKRKGKLTLEDQATFIKKGVPIIFADELDDSKPPPSSSMPLILQEEKAPLPPPEYPNQSVPETT
PLNQDTMGEYTPLRDEDPNAPPYQPPPPFTAPMEGKGSRPKNMTPYRSPPPYVPP

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Restriction Sites SgfI-RsrII      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_004393
ORF Size 2685 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_004393.1, NM_004393.2, NM_004393.3, NM_004393.4, NM_004393.5, NP_004384
RefSeq Size 5493
RefSeq ORF 2688
Locus ID 1605
Cytogenetics 3p21.31
Domains CADG
Protein Families Secreted Protein, Transmembrane, Druggable Genome
Protein Pathways ECM-receptor interaction, Hypertrophic cardiomyopathy (HCM), Arrhythmogenic right ventricular cardiomyopathy (ARVC), Dilated cardiomyopathy, Viral myocarditis
MW 97.54 kDa
Gene Summary Beta-dystroglycan is a transmembrane protein that plays important roles in connecting the extracellular matrix to the cytoskeleton. Acts as a cell adhesion receptor in both muscle and non-muscle tissues. Receptor for both DMD and UTRN and, through these interactions, scaffolds axin to the cytoskeleton. Also functions in cell adhesion-mediated signaling and implicated in cell polarity. [UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (2)