Cortactin(CTTN) (NM_138565) Human Tagged ORF Clone

CAT#: RC201111

CTTN (Myc-DDK-tagged)-Human cortactin (CTTN), transcript variant 2

Clone Modification / Custom Cloning Service

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Cortactin(CTTN) (NM_138565) Human Tagged ORF Clone
Symbol CTTN
Synonyms EMS1
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC201111 representing NM_138565
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTGGAAAGCTTCAGCAGGCCACGCTGTGTCCATCGCCCAGGATGACGCGGGGGCCGATGACTGGGAGA
CCGACCCTGATTTTGTGAATGATGTGAGTGAGAAGGAGCAAAGATGGGGTGCCAAGACGGTGCAGGGCTC
CGGGCACCAGGAGCATATCAACATACACAAGCTGAGGGAGAATGTCTTTCAAGAGCATCAGACCCTTAAG
GAGAAGGAACTTGAAACAGGACCAAAAGCTTCCCATGGCTATGGAGGGAAATTTGGTGTGGAACAAGACC
GAATGGATAAGTCAGCTGTCGGCCACGAATATCAGTCGAAACTTTCCAAGCACTGCTCGCAGGTGGACTC
GGTCCGTGGCTTCGGAGGCAAGTTTGGTGTCCAGATGGACAGAGTTGATCAGTCTGCTGTAGGCTTTGAA
TACCAGGGGAAGACTGAGAAGCATGCCTCCCAGAAAGACTACTCCAGTGGTTTTGGCGGCAAGTATGGCG
TGCAGGCCGACCGAGTAGACAAGAGCGCGGTGGGCTTCGACTACCAGGGCAAGACGGAGAAGCACGAGTC
ACAGAGAGATTACTCCAAAGGTTTCGGCGGCAAATACGGTATCGACAAGGACAAAGTGGATAAGAGCGCC
GTTGGCTTTGAGTATCAAGGCAAAACGGAGAAGCACGAGTCCCAGAAAGACTATGTGAAAGGGTTTGGAG
GAAAATTTGGTGTGCAGACAGACAGACAAGACAAATGTGCCCTTGGCTGGGATCACCAGGAGAAATTGCA
GCTGCATGAATCCCAAAAAGACTACTCCAAAGGATTCGGCGGGAAGTATGGGGTGCAGAAGGATCGGATG
GATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCG
AAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGA
GGACAGGCGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCC
AGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAA
CCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCTGAGCTACAG
AGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGC
AGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCG
CAGAGGACAGCACCTATGATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCA
GGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAACATCGAGATGATTGACGAC
GGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTGGAGCTGCGGCAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC201111 representing NM_138565
Red=Cloning site Green=Tags(s)

MWKASAGHAVSIAQDDAGADDWETDPDFVNDVSEKEQRWGAKTVQGSGHQEHINIHKLRENVFQEHQTLK
EKELETGPKASHGYGGKFGVEQDRMDKSAVGHEYQSKLSKHCSQVDSVRGFGGKFGVQMDRVDQSAVGFE
YQGKTEKHASQKDYSSGFGGKYGVQADRVDKSAVGFDYQGKTEKHESQRDYSKGFGGKYGIDKDKVDKSA
VGFEYQGKTEKHESQKDYVKGFGGKFGVQTDRQDKCALGWDHQEKLQLHESQKDYSKGFGGKYGVQKDRM
DKNASTFEDVTQVSSAYQKTVPVEAVTSKTSNIRANFENLAKEKEQEDRRKAEAERAQRMAKERQEQEEA
RRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVYEDAASFKAELSYRGPVSGTEPEPVYSMEAADYREAS
SQQGLAYATEAVYESAEAPGHYPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDD
GWWRGVCKGRYGLFPANYVELRQ

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_138565
ORF Size 1539 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_138565.1, NM_138565.2, NP_612632
RefSeq Size 3176
RefSeq ORF 1542
Locus ID 2017
Cytogenetics 11q13.3
Protein Families Druggable Genome
Protein Pathways Tight junction, Pathogenic Escherichia coli infection
MW 57.3 kDa
Gene Summary This gene is overexpressed in breast cancer and squamous cell carcinomas of the head and neck. The encoded protein is localized in the cytoplasm and in areas of the cell-substratum contacts. This gene has two roles: (1) regulating the interactions between components of adherens-type junctions and (2) organizing the cytoskeleton and cell adhesion structures of epithelia and carcinoma cells. During apoptosis, the encoded protein is degraded in a caspase-dependent manner. The aberrant regulation of this gene contributes to tumor cell invasion and metastasis. Three splice variants that encode different isoforms have been identified for this gene. [provided by RefSeq, May 2010].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)