NSE (ENO2) (NM_001975) Human Tagged ORF Clone

CAT#: RC201085

Reviews ()
Write a review

ENO2 (Myc-DDK-tagged)-Human enolase 2 (gamma, neuronal) (ENO2)



  "NM_001975" in other vectors (6)

USD 433.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name NSE (ENO2) (NM_001975) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol ENO2
Synonyms HEL-S-279; NSE
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC201085 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCATAGAGAAGATCTGGGCCCGGGAGATCCTGGACTCCCGCGGGAACCCCACAGTGGAGGTGGATC
TCTATACTGCCAAAGGTCTTTTCCGGGCTGCAGTGCCCAGTGGAGCCTCTACGGGCATCTATGAGGCCCT
GGAGCTGAGGGATGGAGACAAACAGCGTTACTTAGGCAAAGGTGTCCTGAAGGCAGTGGACCACATCAAC
TCCACCATCGCGCCAGCCCTCATCAGCTCAGGTCTCTCTGTGGTGGAGCAAGAGAAACTGGACAACCTGA
TGCTGGAGTTGGATGGGACTGAGAACAAATCCAAGTTTGGGGCCAATGCCATCCTGGGTGTGTCTCTGGC
CGTGTGTAAGGCAGGGGCAGCTGAGCGGGAACTGCCCCTGTATCGCCACATTGCTCAGCTGGCCGGGAAC
TCAGACCTCATCCTGCCTGTGCCGGCCTTCAACGTGATCAATGGTGGCTCTCATGCTGGCAACAAGCTGG
CCATGCAGGAGTTCATGATCCTCCCAGTGGGAGCTGAGAGCTTTCGGGATGCCATGCGACTAGGTGCAGA
GGTCTACCATACACTCAAGGGAGTCATCAAGGACAAATACGGCAAGGATGCCACCAATGTGGGGGATGAA
GGTGGCTTTGCCCCCAATATCCTGGAGAACAGTGAAGCCTTGGAGCTGGTGAAGGAAGCCATCGACAAGG
CTGGCTACACGGAAAAGATCGTTATTGGCATGGATGTTGCTGCCTCAGAGTTTTATCGTGATGGCAAATA
TGACTTGGACTTCAAGTCTCCCACTGATCCTTCCCGATACATCACTGGGGACCAGCTGGGGGCACTCTAC
CAGGACTTTGTCAGGGACTATCCTGTGGTCTCCATTGAGGACCCATTTGACCAGGATGATTGGGCTGCCT
GGTCCAAGTTCACAGCCAATGTAGGGATCCAGATTGTGGGTGATGACCTGACAGTGACCAACCCAAAACG
TATTGAGCGGGCAGTGGAAGAAAAGGCCTGCAACTGTCTGCTGCTCAAGGTCAACCAGATCGGCTCTGTC
ACTGAAGCCATCCAAGCGTGCAAGCTGGCCCAGGAGAATGGCTGGGGGGTCATGGTGAGTCATCGCTCAG
GAGAGACTGAGGACACATTCATTGCTGACCTGGTGGTGGGGCTGTGCACAGGCCAGATCAAGACTGGTGC
CCCGTGCCGTTCTGAACGTCTGGCTAAATACAACCAGCTCATGAGAATTGAGGAAGAGCTGGGGGATGAA
GCTCGCTTTGCCGGACATAACTTCCGTAATCCCAGTGTGCTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC201085 protein sequence
Red=Cloning site Green=Tags(s)

MSIEKIWAREILDSRGNPTVEVDLYTAKGLFRAAVPSGASTGIYEALELRDGDKQRYLGKGVLKAVDHIN
STIAPALISSGLSVVEQEKLDNLMLELDGTENKSKFGANAILGVSLAVCKAGAAERELPLYRHIAQLAGN
SDLILPVPAFNVINGGSHAGNKLAMQEFMILPVGAESFRDAMRLGAEVYHTLKGVIKDKYGKDATNVGDE
GGFAPNILENSEALELVKEAIDKAGYTEKIVIGMDVAASEFYRDGKYDLDFKSPTDPSRYITGDQLGALY
QDFVRDYPVVSIEDPFDQDDWAAWSKFTANVGIQIVGDDLTVTNPKRIERAVEEKACNCLLLKVNQIGSV
TEAIQACKLAQENGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIEEELGDE
ARFAGHNFRNPSVL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001975
ORF Size 1302 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001975.3
RefSeq Size 2423 bp
RefSeq ORF 1305 bp
Locus ID 2026
Cytogenetics 12p13.31
Domains enolase
Protein Pathways Glycolysis / Gluconeogenesis, Metabolic pathways, RNA degradation
MW 47.3 kDa
Gene Summary This gene encodes one of the three enolase isoenzymes found in mammals. This isoenzyme, a homodimer, is found in mature neurons and cells of neuronal origin. A switch from alpha enolase to gamma enolase occurs in neural tissue during development in rats and primates. [provided by RefSeq, Jul 2008]

Other Versions

Other products for "ENO2"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 350.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


NSE mouse monoclonal antibody, clone OTI3C1
    • 100 ul

USD 379.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools