ACSL5 (NM_016234) Human Tagged ORF Clone

CAT#: RC201076

Reviews ()
Write a review
  • TrueORF®

ACSL5 (Myc-DDK-tagged)-Human acyl-CoA synthetase long-chain family member 5 (ACSL5), transcript variant 1



  "NM_016234" in other vectors (6)

USD 780.00


Availability*
2 Weeks

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name ACSL5 (NM_016234) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol ACSL5
Synonyms ACS2; ACS5; FACL5
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC201076 representing NM_016234
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACGCTCTGAAGCCACCCTGTCTCTGGAGGAACCACGAGCGAGGGAAGAAGGACAGGGACTCGTGTG
GCAGGAAGAACTCAGAGCCGGGAAGCCCCCATTCACTAGAAGCACTGAGAGATGCGGCCCCCTCGCAGGG
TCTGAATTTCCTGCTGCTGTTCACAAAGATGCTTTTTATCTTTAACTTTTTGTTTTCCCCACTTCCGACC
CCGGCGTTGATCTGCATCCTGACATTTGGAGCTGCCATCTTCTTGTGGCTGATCACCAGACCTCAACCCG
TCTTACCTCTTCTTGACCTGAACAATCAGTCTGTGGGAATTGAGGGAGGAGCACGGAAGGGGGTTTCCCA
GAAGAACAATGACCTAACAAGTTGCTGCTTCTCAGATGCCAAGACTATGTATGAGGTTTTCCAAAGAGGA
CTCGCTGTGTCTGACAATGGGCCCTGCTTGGGATATAGAAAACCAAACCAGCCCTACAGATGGCTATCTT
ACAAACAGGTGTCTGATAGAGCAGAGTACCTGGGTTCCTGTCTCTTGCATAAAGGTTATAAATCATCACC
AGACCAGTTTGTCGGCATCTTTGCTCAGAATAGGCCAGAGTGGATCATCTCCGAATTGGCTTGTTACACG
TACTCTATGGTAGCTGTACCTCTGTATGACACCTTGGGACCAGAAGCCATCGTACATATTGTCAACAAGG
CTGATATCGCCATGGTGATCTGTGACACACCCCAAAAGGCATTGGTGCTGATAGGGAATGTAGAGAAAGG
CTTCACCCCGAGCCTGAAGGTGATCATCCTTATGGACCCCTTTGATGATGACCTGAAGCAAAGAGGGGAG
AAGAGTGGAATTGAGATCTTATCCCTATATGATGCTGAGAACCTAGGCAAAGAGCACTTCAGAAAACCTG
TGCCTCCTAGCCCAGAAGACCTGAGCGTCATCTGCTTCACCAGTGGGACCACAGGTGACCCCAAAGGAGC
CATGATAACCCATCAAAATATTGTTTCAAATGCTGCTGCCTTTCTCAAATGTGTGGAGCATGCTTATGAG
CCCACTCCTGATGATGTGGCCATATCCTACCTCCCTCTGGCTCATATGTTTGAGAGGATTGTACAGGCTG
TTGTGTACAGCTGTGGAGCCAGAGTTGGATTCTTCCAAGGGGATATTCGGTTGCTGGCTGACGACATGAA
GACTTTGAAGCCCACATTGTTTCCCGCGGTGCCTCGACTCCTTAACAGGATCTACGATAAGGTACAAAAT
GAGGCCAAGACACCCTTGAAGAAGTTCTTGTTGAAGCTGGCTGTTTCCAGTAAATTCAAAGAGCTTCAAA
AGGGTATCATCAGGCATGATAGTTTCTGGGACAAGCTCATCTTTGCAAAGATCCAGGACAGCCTGGGCGG
AAGGGTTCGTGTAATTGTCACTGGAGCTGCCCCCATGTCCACTTCAGTCATGACATTCTTCCGGGCAGCA
ATGGGATGTCAGGTGTATGAAGCTTATGGTCAAACAGAATGCACAGGTGGCTGTACATTTACATTACCTG
GGGACTGGACATCAGGTCACGTTGGGGTGCCCCTGGCTTGCAATTACGTGAAGCTGGAAGATGTGGCTGA
CATGAACTACTTTACAGTGAATAATGAAGGAGAGGTCTGCATCAAGGGTACAAACGTGTTCAAAGGATAC
CTGAAGGACCCTGAGAAGACACAGGAAGCCCTGGACAGTGATGGCTGGCTTCACACAGGAGACATTGGTC
GCTGGCTCCCGAATGGAACTCTGAAGATCATCGACCGTAAAAAGAACATTTTCAAGCTGGCCCAAGGAGA
ATACATTGCACCAGAGAAGATAGAAAATATCTACAACAGGAGTCAACCAGTGTTACAAATTTTTGTACAC
GGGGAGAGCTTACGGTCATCCTTAGTAGGAGTGGTGGTTCCTGACACAGATGTACTTCCCTCATTTGCAG
CCAAGCTTGGGGTGAAGGGCTCCTTTGAGGAACTGTGCCAAAACCAAGTTGTAAGGGAAGCCATTTTAGA
AGACTTGCAGAAAATTGGGAAAGAAAGTGGCCTTAAAACTTTTGAACAGGTCAAAGCCATTTTTCTTCAT
CCAGAGCCATTTTCCATTGAAAATGGGCTCTTGACACCAACATTGAAAGCAAAGCGAGGAGAGCTTTCCA
AATACTTTCGGACCCAAATTGACAGCCTGTATGAGCACATCCAGGAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC201076 representing NM_016234
Red=Cloning site Green=Tags(s)

MDALKPPCLWRNHERGKKDRDSCGRKNSEPGSPHSLEALRDAAPSQGLNFLLLFTKMLFIFNFLFSPLPT
PALICILTFGAAIFLWLITRPQPVLPLLDLNNQSVGIEGGARKGVSQKNNDLTSCCFSDAKTMYEVFQRG
LAVSDNGPCLGYRKPNQPYRWLSYKQVSDRAEYLGSCLLHKGYKSSPDQFVGIFAQNRPEWIISELACYT
YSMVAVPLYDTLGPEAIVHIVNKADIAMVICDTPQKALVLIGNVEKGFTPSLKVIILMDPFDDDLKQRGE
KSGIEILSLYDAENLGKEHFRKPVPPSPEDLSVICFTSGTTGDPKGAMITHQNIVSNAAAFLKCVEHAYE
PTPDDVAISYLPLAHMFERIVQAVVYSCGARVGFFQGDIRLLADDMKTLKPTLFPAVPRLLNRIYDKVQN
EAKTPLKKFLLKLAVSSKFKELQKGIIRHDSFWDKLIFAKIQDSLGGRVRVIVTGAAPMSTSVMTFFRAA
MGCQVYEAYGQTECTGGCTFTLPGDWTSGHVGVPLACNYVKLEDVADMNYFTVNNEGEVCIKGTNVFKGY
LKDPEKTQEALDSDGWLHTGDIGRWLPNGTLKIIDRKKNIFKLAQGEYIAPEKIENIYNRSQPVLQIFVH
GESLRSSLVGVVVPDTDVLPSFAAKLGVKGSFEELCQNQVVREAILEDLQKIGKESGLKTFEQVKAIFLH
PEPFSIENGLLTPTLKAKRGELSKYFRTQIDSLYEHIQD

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_016234
ORF Size 2217 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_016234.3, NP_057318.2
RefSeq Size 3372 bp
RefSeq ORF 2220 bp
Locus ID 51703
Cytogenetics 10q25.2
Domains AMP-binding
Protein Families Transmembrane
Protein Pathways Adipocytokine signaling pathway, Fatty acid metabolism, Metabolic pathways, PPAR signaling pathway
MW 82.1 kDa
Gene Summary The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme is highly expressed in uterus and spleen, and in trace amounts in normal brain, but has markedly increased levels in malignant gliomas. This gene functions in mediating fatty acid-induced glioma cell growth. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Citations (1)

Other Versions

Other products for "ACSL5"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


ACSL5 mouse monoclonal antibody,clone OTI3A3
    • 100 ul

USD 379.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools