Sodium Potassium ATPase(ATP1A1) (NM_000701) Human Tagged ORF Clone

CAT#: RC201009

ATP1A1 (Myc-DDK-tagged)-Human ATPase, Na+/K+ transporting, alpha 1 polypeptide (ATP1A1), transcript variant 1

Need custom modification / cloning service?
Get a free quote

USD 98.00

USD 800.00


Availability*
In Stock

Size
    • 10 ug

Cited in 2 publications.

Product images

Specifications

Product Data
Product Name Sodium Potassium ATPase(ATP1A1) (NM_000701) Human Tagged ORF Clone
Symbol ATP1A1
Synonyms MGC3285; MGC51750
Vector pCMV6-Entry
Sequence Data
>RC201009 representing NM_000701
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGAAGGGGGTTGGACGTGATAAGTATGAGCCTGCAGCTGTTTCAGAACAAGGTGATAAAAAGGGCA
AAAAGGGCAAAAAAGACAGGGACATGGATGAACTGAAGAAAGAAGTTTCTATGGATGATCATAAACTTAG
CCTTGATGAACTTCATCGTAAATATGGAACAGACTTGAGCCGGGGATTAACATCTGCTCGTGCAGCTGAG
ATCCTGGCGCGAGATGGTCCCAACGCCCTCACTCCCCCTCCCACTACTCCTGAATGGATCAAGTTTTGTC
GGCAGCTCTTTGGGGGGTTCTCAATGTTACTGTGGATTGGAGCGATTCTTTGTTTCTTGGCTTATAGCAT
CCAAGCTGCTACAGAAGAGGAACCTCAAAACGATAATCTGTACCTGGGTGTGGTGCTATCAGCCGTTGTA
ATCATAACTGGTTGCTTCTCCTACTATCAAGAAGCTAAAAGTTCAAAGATCATGGAATCCTTCAAAAACA
TGGTCCCTCAGCAAGCCCTTGTGATTCGAAATGGTGAGAAAATGAGCATAAATGCGGAGGAAGTTGTGGT
TGGGGATCTGGTGGAAGTAAAAGGAGGAGACCGAATTCCTGCTGACCTCAGAATCATATCTGCAAATGGC
TGCAAGGTGGATAACTCCTCGCTCACTGGTGAATCAGAACCCCAGACTAGGTCTCCAGATTTCACAAATG
AAAACCCCCTGGAGACGAGGAACATTGCCTTCTTTTCAACCAATTGTGTTGAAGGCACCGCACGTGGTAT
TGTTGTCTACACTGGGGATCGCACTGTGATGGGAAGAATTGCCACACTTGCTTCTGGGCTGGAAGGAGGC
CAGACCCCCATTGCTGCAGAAATTGAACATTTTATCCACATCATCACGGGTGTGGCTGTGTTCCTGGGTG
TGTCTTTCTTCATCCTTTCTCTCATCCTTGAGTACACCTGGCTTGAGGCTGTCATCTTCCTCATCGGTAT
CATCGTAGCCAATGTGCCGGAAGGTTTGCTGGCCACTGTCACGGTCTGTCTGACACTTACTGCCAAACGC
ATGGCAAGGAAAAACTGCTTAGTGAAGAACTTAGAAGCTGTGGAGACCTTGGGGTCCACATCCACCATCT
GCTCTGATAAAACTGGAACTCTGACTCAGAACCGGATGACAGTGGCCCACATGTGGTTTGACAATCAAAT
CCATGAAGCTGATACGACAGAGAATCAGAGTGGTGTCTCTTTTGACAAGACTTCAGCTACCTGGCTTGCT
CTGTCCAGAATTGCAGGTCTTTGTAACAGGGCAGTGTTTCAGGCTAACCAGGAAAACCTACCTATTCTTA
AGCGGGCAGTTGCAGGAGATGCCTCTGAGTCAGCACTCTTAAAGTGCATAGAGCTGTGCTGTGGTTCCGT
GAAGGAGATGAGAGAAAGATACGCCAAAATCGTCGAGATACCCTTCAACTCCACCAACAAGTACCAGTTG
TCTATTCATAAGAACCCCAACACATCAGAGCCCCAACACCTGTTGGTGATGAAGGGCGCCCCAGAAAGGA
TCCTAGACCGTTGCAGCTCTATCCTCCTCCACGGCAAGGAGCAGCCCCTGGATGAGGAGCTGAAAGACGC
CTTTCAGAACGCCTATTTGGAGCTGGGGGGCCTCGGAGAACGAGTCCTAGGTTTCTGCCACCTCTTTCTG
CCAGATGAACAGTTTCCTGAAGGGTTCCAGTTTGACACTGACGATGTGAATTTCCCTATCGATAATCTGT
GCTTTGTTGGGCTCATCTCCATGATTGACCCTCCACGGGCGGCCGTTCCTGATGCCGTGGGCAAATGTCG
AAGTGCTGGAATTAAGGTCATCATGGTCACAGGAGACCATCCAATCACAGCTAAAGCTATTGCCAAAGGT
GTGGGCATCATCTCAGAAGGCAATGAGACCGTGGAAGACATTGCTGCCCGCCTCAACATCCCAGTCAGCC
AGGTGAACCCCAGGGATGCCAAGGCCTGCGTAGTACACGGCAGTGATCTAAAGGACATGACCTCCGAGCA
GCTGGATGACATTTTGAAGTACCACACTGAGATAGTGTTTGCCAGGACCTCCCCTCAGCAGAAGCTCATC
ATTGTGGAAGGCTGCCAAAGACAGGGTGCTATCGTGGCTGTGACTGGTGACGGTGTGAATGACTCTCCAG
CTTTGAAGAAAGCAGACATTGGGGTTGCTATGGGGATTGCTGGCTCAGATGTGTCCAAGCAAGCTGCTGA
CATGATTCTTCTGGATGACAACTTTGCCTCAATTGTGACTGGAGTAGAGGAAGGTCGTCTGATCTTTGAT
AACTTGAAGAAATCCATTGCTTATACCTTAACCAGTAACATTCCCGAGATCACCCCGTTCCTGATATTTA
TTATTGCAAACATTCCACTACCACTGGGGACTGTCACCATCCTCTGCATTGACTTGGGCACTGACATGGT
TCCTGCCATCTCCCTGGCTTATGAGCAGGCTGAGAGTGACATCATGAAGAGACAGCCCAGAAATCCCAAA
ACAGACAAACTTGTGAATGAGCGGCTGATCAGCATGGCCTATGGGCAGATTGGAATGATCCAGGCCCTGG
GAGGCTTCTTTACTTACTTTGTGATTCTGGCTGAGAACGGCTTCCTCCCAATTCACCTGTTGGGCCTCCG
AGTGGACTGGGATGACCGCTGGATCAACGATGTGGAAGACAGCTACGGGCAGCAGTGGACCTATGAGCAG
AGGAAAATCGTGGAGTTCACCTGCCACACAGCCTTCTTCGTCAGTATCGTGGTGGTGCAGTGGGCCGACT
TGGTCATCTGTAAGACCAGGAGGAATTCGGTCTTCCAGCAGGGGATGAAGAACAAGATCTTGATATTTGG
CCTCTTTGAAGAGACAGCCCTGGCTGCTTTCCTTTCCTACTGCCCTGGAATGGGTGTTGCTCTTAGGATG
TATCCCCTCAAACCTACCTGGTGGTTCTGTGCCTTCCCCTACTCTCTTCTCATCTTCGTATATGACGAAG
TCAGAAAACTCATCATCAGGCGACGCCCTGGCGGCTGGGTGGAGAAGGAAACCTACTAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC201009 representing NM_000701
Red=Cloning site Green=Tags(s)

MGKGVGRDKYEPAAVSEQGDKKGKKGKKDRDMDELKKEVSMDDHKLSLDELHRKYGTDLSRGLTSARAAE
ILARDGPNALTPPPTTPEWIKFCRQLFGGFSMLLWIGAILCFLAYSIQAATEEEPQNDNLYLGVVLSAVV
IITGCFSYYQEAKSSKIMESFKNMVPQQALVIRNGEKMSINAEEVVVGDLVEVKGGDRIPADLRIISANG
CKVDNSSLTGESEPQTRSPDFTNENPLETRNIAFFSTNCVEGTARGIVVYTGDRTVMGRIATLASGLEGG
QTPIAAEIEHFIHIITGVAVFLGVSFFILSLILEYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKR
MARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTENQSGVSFDKTSATWLA
LSRIAGLCNRAVFQANQENLPILKRAVAGDASESALLKCIELCCGSVKEMRERYAKIVEIPFNSTNKYQL
SIHKNPNTSEPQHLLVMKGAPERILDRCSSILLHGKEQPLDEELKDAFQNAYLELGGLGERVLGFCHLFL
PDEQFPEGFQFDTDDVNFPIDNLCFVGLISMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKG
VGIISEGNETVEDIAARLNIPVSQVNPRDAKACVVHGSDLKDMTSEQLDDILKYHTEIVFARTSPQQKLI
IVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFD
NLKKSIAYTLTSNIPEITPFLIFIIANIPLPLGTVTILCIDLGTDMVPAISLAYEQAESDIMKRQPRNPK
TDKLVNERLISMAYGQIGMIQALGGFFTYFVILAENGFLPIHLLGLRVDWDDRWINDVEDSYGQQWTYEQ
RKIVEFTCHTAFFVSIVVVQWADLVICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMGVALRM
YPLKPTWWFCAFPYSLLIFVYDEVRKLIIRRRPGGWVEKETYY

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_000701
ORF Size 3069 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_000701.2, NM_000701.3, NM_000701.4, NM_000701.5, NM_000701.6, NM_000701.7, NP_000692
RefSeq Size 3713
RefSeq ORF 3072
Locus ID 476
Cytogenetics 1p13.1
Domains E1-E2_ATPase, Cation_ATPase_N, Hydrolase, Cation_ATPase_C
Protein Families Transmembrane, Druggable Genome
Protein Pathways Cardiac muscle contraction
MW 112.7 kDa
Gene Summary This is the catalytic component of the active enzyme, which catalyzes the hydrolysis of ATP coupled with the exchange of sodium and potassium ions across the plasma membrane. This action creates the electrochemical gradient of sodium and potassium ions, providing the energy for active transport of various nutrients. [UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (2)