MCHR(MCHR1) (NM_005297) Human Tagged ORF Clone

CAT#: RC200997

MCHR1 (Myc-DDK-tagged)-Human melanin-concentrating hormone receptor 1 (MCHR1)

Change vector?

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name MCHR(MCHR1) (NM_005297) Human Tagged ORF Clone
Symbol MCHR1
Synonyms GPR24; MCH-1R; MCH1R; SLC-1; SLC1
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC200997 representing NM_005297
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCAGTGGGAGCCATGAAGAAGGGAGTGGGGAGGGCAGTTGGGCTTGGAGGCGGCAGCGGCTGCCAGG
CTACGGAGGAAGACCCCCTTCCCGACTGCGGGGCTTGCGCTCCGGGACAAGGTGGCAGGCGCTGGAGGCT
GCCGCAGCCTGCGTGGGTGGAGGGGAGCTCAGCTCGGTTGTGGGAGCAGGCGACCGGCACTGGCTGGATG
GACCTGGAAGCCTCGCTGCTGCCCACTGGTCCCAATGCCAGCAACACCTCTGATGGCCCCGATAACCTCA
CTTCGGCAGGATCACCTCCTCGCACGGGGAGCATCTCCTACATCAACATCATCATGCCTTCGGTGTTCGG
CACCATCTGCCTCCTGGGCATCATCGGGAACTCCACGGTCATCTTCGCGGTCGTGAAGAAGTCCAAGCTG
CACTGGTGCAACAACGTCCCCGACATCTTCATCATCAACCTCTCGGTAGTAGATCTCCTCTTTCTCCTGG
GCATGCCCTTCATGATCCACCAGCTCATGGGCAATGGGGTGTGGCACTTTGGGGAGACCATGTGCACCCT
CATCACGGCCATGGATGCCAATATTCAGTTCACCAGCACCTACATCCTGACCGCCATGGCCATTGACCGC
TACCTGGCCACTGTCCACCCCATCTCTTCCACGAAGTTCCGGAAGCCCTCTGTGGCCACCCTGGTGATCT
GCCTCCTGTGGGCCCTCTCCTTCATCAGCATCACCCCTGTGTGGCTGTATGCCAGACTCATCCCCTTCCC
AGGAGGTGCAGTGGGCTGCGGCATACGCCTGCCCAACCCAGACACTGACCTCTACTGGTTCACCCTGTAC
CAGTTTTTCCTGGCCTTTGCCCTGCCTTTTGTGGTCATCACAGCCGCATACGTGAGGATCCTGCAGCGCA
TGACGTCCTCAGTGGCCCCCGCCTCCCAGCGCAGCATCCGGCTGCGGACAAAGAGGGTGACCCGCACAGC
CATCGCCATCTGTCTGGTCTTCTTTGTGTGCTGGGCACCCTACTATGTGCTACAGCTGACCCAGTTGTCC
ATCAGCCGCCCGACCCTCACCTTTGTCTACTTATACAATGCGGCCATCAGCTTGGGCTATGCCAACAGCT
GCCTCAACCCCTTTGTGTACATCGTGCTCTGTGAGACGTTCCGCAAACGCTTGGTCCTGTCGGTGAAGCC
TGCAGCCCAGGGGCAGCTTCGCGCTGTCAGCAACGCTCAGACGGCTGACGAGGAGAGGACAGAAAGCAAA
GGCACC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC200997 representing NM_005297
Red=Cloning site Green=Tags(s)

MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPDCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWM
DLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKL
HWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANIQFTSTYILTAMAIDR
YLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLY
QFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLS
ISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESK
GT

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_005297
ORF Size 1266 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_005297.2, NM_005297.3, NP_005288
RefSeq Size 2423
Locus ID 2847
Cytogenetics 22q13.2
Protein Families GPCR, Transmembrane, Druggable Genome
Protein Pathways Neuroactive ligand-receptor interaction
MW 45.8 kDa
Gene Summary The protein encoded by this gene, a member of the G protein-coupled receptor family 1, is an integral plasma membrane protein which binds melanin-concentrating hormone. The encoded protein can inhibit cAMP accumulation and stimulate intracellular calcium flux, and is probably involved in the neuronal regulation of food consumption. Although structurally similar to somatostatin receptors, this protein does not seem to bind somatostatin. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.