MACROD1 (NM_014067) Human Tagged ORF Clone

CAT#: RC200992

Reviews ()
Write a review

MACROD1 (Myc-DDK-tagged)-Human MACRO domain containing 1 (MACROD1)



  "NM_014067" in other vectors (6)

Reconstitution Protocol

USD 300.00

USD 450.00

In Stock*

Size
    • 10 ug

Product images

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "MACROD1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol MACROD1
Synonyms LRP16
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC200992 representing NM_014067
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCTCTACAGAGCCGACTGTCCGGCCGCCTGGCACAGCTGCGCGCGGCGGGGCAGCTGCTCGTCCCCC
CGCGCCCCCGGCCCGGACACTTGGCGGGTGCCACGAGGACCCGCAGCAGCACGTGCGGTCCCCCGGCGTT
CCTGGGCGTGTTCGGCCGCCGTGCGCGGACCTCGGCGGGAGTTGGGGCGTGGGGGGCGGCGGCGGTGGGG
CGGACAGCCGGGGTGCGCACTTGGGCCCCCCTGGCCATGGCGGCGAAGGTGGACCTGAGCACCTCCACCG
ACTGGAAGGAGGCGAAATCCTTTCTGAAGGGCCTGAGTGACAAGCAGCGGGAGGAACATTACTTCTGCAA
GGACTTTGTCAGGCTGAAGAAGATCCCGACATGGAAGGAGATGGCGAAAGGGGTGGCTGTGAAGGTGGAG
GAGCCCAGGTATAAAAAGGACAAGCAGCTCAATGAGAAAATCTCCCTGCTCCGCAGCGACATCACCAAGC
TGGAGGTGGACGCCATCGTCAACGCCGCCAACAGCTCCCTGCTCGGAGGCGGTGGCGTGGACGGCTGCAT
TCATCGGGCCGCCGGCCCCCTGCTTACCGACGAGTGCCGGACCCTGCAGAGCTGTAAGACTGGCAAGGCC
AAGATCACCGGCGGCTATCGGCTCCCGGCCAAGTACGTCATCCACACAGTGGGGCCCATCGCCTACGGGG
AGCCCAGCGCCAGCCAGGCTGCCGAGCTCCGCAGCTGCTACCTGAGCAGTCTGGACCTGCTGCTGGAGCA
CCGGCTCCGCTCGGTGGCGTTCCCCTGCATCTCCACCGGCGTGTTTGGCTACCCCTGTGAGGCGGCCGCC
GAGATCGTGCTGGCCACGCTGCGAGAGTGGCTGGAGCAGCACAAGGACAAGGTGGACCGGCTGATCATCT
GCGTGTTCCTCGAGAAGGACGAGGACATCTACCGGAGCCGGCTCCCCCACTACTTCCCCGTGGCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200992 representing NM_014067
Red=Cloning site Green=Tags(s)

MSLQSRLSGRLAQLRAAGQLLVPPRPRPGHLAGATRTRSSTCGPPAFLGVFGRRARTSAGVGAWGAAAVG
RTAGVRTWAPLAMAAKVDLSTSTDWKEAKSFLKGLSDKQREEHYFCKDFVRLKKIPTWKEMAKGVAVKVE
EPRYKKDKQLNEKISLLRSDITKLEVDAIVNAANSSLLGGGGVDGCIHRAAGPLLTDECRTLQSCKTGKA
KITGGYRLPAKYVIHTVGPIAYGEPSASQAAELRSCYLSSLDLLLEHRLRSVAFPCISTGVFGYPCEAAA
EIVLATLREWLEQHKDKVDRLIICVFLEKDEDIYRSRLPHYFPVA

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_014067
ORF Size 975 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_014067.2, NP_054786.2
RefSeq Size 1225 bp
RefSeq ORF 978 bp
Locus ID 28992
UniProt ID Q9BQ69
Cytogenetics 11q13.1
MW 35.3 kDa
Gene Summary Removes ADP-ribose from asparatate and glutamate residues in proteins bearing a single ADP-ribose moiety (PubMed:23474714, PubMed:23474712). Inactive towards proteins bearing poly-ADP-ribose (PubMed:23474714, PubMed:23474712). Deacetylates O-acetyl-ADP ribose, a signaling molecule generated by the deacetylation of acetylated lysine residues in histones and other proteins (PubMed:21257746). Plays a role in estrogen signaling (PubMed:17893710, PubMed:17914104, PubMed:19403568). Binds to androgen receptor (AR) and amplifies the transactivation function of AR in response to androgen (PubMed:19022849). May play an important role in carcinogenesis and/or progression of hormone-dependent cancers by feed-forward mechanism that activates ESR1 transactivation (PubMed:17893710, PubMed:17914104). Could be an ESR1 coactivator, providing a positive feedback regulatory loop for ESR1 signal transduction (PubMed:17914104). Could be involved in invasive growth by down-regulating CDH1 in endometrial cancer cells (PubMed:17893710). Enhances ESR1-mediated transcription activity (PubMed:17914104).[UniProtKB/Swiss-Prot Function]

Other Versions

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.