PDXK (NM_003681) Human Tagged ORF Clone

CAT#: RC200975

Reviews ()
Write a review

PDXK (Myc-DDK-tagged)-Human pyridoxal (pyridoxine, vitamin B6) kinase (PDXK)


  "NM_003681" in other vectors (6)

USD 98.00

USD 470.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name PDXK (NM_003681) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol PDXK
Synonyms C21orf97; C21orf124; HEL-S-1a; PKH; PNK; PRED79
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC200975 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGGAGGAGTGCCGGGTGCTCTCCATACAGAGCCACGTCATCCGCGGCTACGTGGGCAACCGGGCGG
CCACGTTCCCGCTGCAGGTTTTGGGATTTGAGATTGACGCGGTGAACTCTGTCCAGTTTTCAAACCACAC
AGGCTATGCCCACTGGAAGGGCCAAGTGCTGAATTCAGATGAGCTCCAGGAGTTGTACGAAGGCCTGAGG
CTGAACAACATGAATAAATATGACTACGTGCTCACAGGTTATACGAGGGACAAGTCGTTCCTGGCCATGG
TGGTGGACATTGTGCAGGAGCTGAAGCAGCAGAACCCCAGGCTGGTGTACGTGTGTGATCCAGTCTTGGG
TGACAAGTGGGACGGCGAAGGCTCGATGTACGTCCCGGAGGACCTCCTTCCCGTCTACAAAGAAAAAGTG
GTGCCGCTTGCAGACATTATCACGCCCAACCAGTTTGAGGCCGAGTTACTGAGTGGCCGGAAGATCCACA
GCCAGGAGGAAGCCTTGCGGGTGATGGACATGCTGCACTCTATGGGCCCCGACACCGTGGTCATCACCAG
CTCCGACCTGCCCTCCCCGCAGGGCAGCAACTACCTGATTGTGCTGGGGAGTCAGAGGAGGAGGAATCCC
GCTGGCTCCGTGGTGATGGAACGCATCCGGATGGACATTCGCAAAGTGGACGCCGTCTTTGTGGGCACTG
GGGACCTGTTTGCTGCCATGCTCCTGGCGTGGACACACAAGCACCCCAATAACCTCAAGGTGGCCTGTGA
GAAGACCGTGTCTACCTTGCACCACGTTCTGCAGAGGACCATCCAGTGTGCAAAAGCCCAGGCCGGGGAA
GGAGTGAGGCCCAGCCCCATGCAGCTGGAGCTGCGGATGGTGCAGAGCAAAAGGGACATCGAGGACCCAG
AGATCGTCGTCCAGGCCACGGTGCTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200975 protein sequence
Red=Cloning site Green=Tags(s)

MEEECRVLSIQSHVIRGYVGNRAATFPLQVLGFEIDAVNSVQFSNHTGYAHWKGQVLNSDELQELYEGLR
LNNMNKYDYVLTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVLGDKWDGEGSMYVPEDLLPVYKEKV
VPLADIITPNQFEAELLSGRKIHSQEEALRVMDMLHSMGPDTVVITSSDLPSPQGSNYLIVLGSQRRRNP
AGSVVMERIRMDIRKVDAVFVGTGDLFAAMLLAWTHKHPNNLKVACEKTVSTLHHVLQRTIQCAKAQAGE
GVRPSPMQLELRMVQSKRDIEDPEIVVQATVL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_003681
ORF Size 936 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_003681.1, NM_003681.2, NM_003681.3, NM_003681.4, NP_003672.1
RefSeq Size 7390
RefSeq ORF 939
Locus ID 8566
Cytogenetics 21q22.3
Domains pfkB
Protein Families Druggable Genome
Protein Pathways Metabolic pathways, Vitamin B6 metabolism
MW 35.1 kDa
Gene Summary The protein encoded by this gene phosphorylates vitamin B6, a step required for the conversion of vitamin B6 to pyridoxal-5-phosphate, an important cofactor in intermediary metabolism. The encoded protein is cytoplasmic and probably acts as a homodimer. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq, Jul 2008]

Other Versions

Other products for "PDXK"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


PDXK mouse monoclonal antibody, clone OTI5H5 (formerly 5H5)
    • 100 ul

USD 379.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools