DBNDD1 (NM_024043) Human Tagged ORF Clone

CAT#: RC200971

DBNDD1 (Myc-DDK-tagged)-Human dysbindin (dystrobrevin binding protein 1) domain containing 1 (DBNDD1), transcript variant 2

Need custom modification / cloning service?
Get a free quote

USD 98.00

USD 390.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name DBNDD1 (NM_024043) Human Tagged ORF Clone
Symbol DBNDD1
Synonyms FLJ12582; MGC3101
Vector pCMV6-Entry
Sequence Data
>RC200971 representing NM_024043
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGAGAAACCTGGAAGAATATTTGCTCAACTGTGAGGCATGGTTGGTGGCTAAGGGATCACAGAATGG
CAGGCCTGCCTATTCCTCCTGAGATCGTTAAGGAGGCTGAGGTGCCGCAGGCTGCGCTGGGCGTCCCAGC
CCAGGGGACAGGGGACAATGGCCACACGCCTGTGGAGGAGGAGGTCGGGGGCATCCCAGTACCAGCACCG
GGGCTCCTGCAGGTCACGGAGAGGAGGCAGCCTCTGAGCAGCGTCTCCTCTCTGGAGGTCCACTTCGACC
TCCTGGACCTCACTGAGCTCACCGACATGTCGGACCAGGAGCTGGCCGAGGTCTTTGCTGACTCGGACGA
CGAGAACCTCAACACCGAGTCCCCAGCAGGTCTGCACCCGCTGCCCCGGGCCGGCTACCTGCGCTCCCCT
TCCTGGACGAGGACAAGGGCTGAGCAGAGCCACGAGAAGCAGCCCCTAGGCGACCCCGAGCGGCAGGCCA
CAGTCCTGGACACGTTTCTCACTGTGGAGAGGCCCCAGGAGGAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200971 representing NM_024043
Red=Cloning site Green=Tags(s)

MGETWKNICSTVRHGWWLRDHRMAGLPIPPEIVKEAEVPQAALGVPAQGTGDNGHTPVEEEVGGIPVPAP
GLLQVTERRQPLSSVSSLEVHFDLLDLTELTDMSDQELAEVFADSDDENLNTESPAGLHPLPRAGYLRSP
SWTRTRAEQSHEKQPLGDPERQATVLDTFLTVERPQED

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_024043
ORF Size 534 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_024043.2, NM_024043.3, NP_076948
RefSeq Size 2096
RefSeq ORF 537
Locus ID 79007
Cytogenetics 16q24.3
MW 19.5 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.